mirror of
https://github.com/ml-explore/mlx-examples.git
synced 2025-12-16 02:08:55 +08:00
53 lines
1.8 KiB
Python
53 lines
1.8 KiB
Python
|
|
import time
|
||
|
|
|
||
|
|
import torch
|
||
|
|
from transformers import AutoTokenizer, EsmForMaskedLM
|
||
|
|
|
||
|
|
# Example protein sequence (Green Fluorescent Protein)
|
||
|
|
protein_sequence = "MSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVTTFSYGVQCFSRYPDHMKQHDFFKSAMPEGYVQERTIFFKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYNSHNVYIMADKQKNGIKVNFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSTQSALSKDPNEKRDHMVLLEFVTAAGITHGMDELYK"
|
||
|
|
|
||
|
|
# Hugging Face model identifier for ESM-2 (33 layers, 650M params, UR50D training set)
|
||
|
|
model_name = "facebook/esm2_t33_650M_UR50D"
|
||
|
|
|
||
|
|
# Load tokenizer and model; move model to Apple Metal Performance Shaders (MPS) device
|
||
|
|
tokenizer = AutoTokenizer.from_pretrained(model_name)
|
||
|
|
model = EsmForMaskedLM.from_pretrained(model_name).to("mps")
|
||
|
|
|
||
|
|
# Number of sequences per forward pass
|
||
|
|
batch_size = 5
|
||
|
|
|
||
|
|
# Number of timing iterations
|
||
|
|
steps = 50
|
||
|
|
|
||
|
|
# Tokenize input sequence and replicate for the batch
|
||
|
|
# Replicate the same sequence 'batch_size' times to create a batch
|
||
|
|
inputs = tokenizer(
|
||
|
|
[protein_sequence] * batch_size,
|
||
|
|
return_tensors="pt",
|
||
|
|
padding=True,
|
||
|
|
truncation=True,
|
||
|
|
max_length=1024,
|
||
|
|
)
|
||
|
|
input_ids = inputs["input_ids"].to("mps")
|
||
|
|
attention_mask = inputs["attention_mask"].to("mps")
|
||
|
|
|
||
|
|
# Warm-up phase
|
||
|
|
for _ in range(10):
|
||
|
|
outputs = model(input_ids=input_ids, attention_mask=attention_mask)
|
||
|
|
torch.mps.synchronize() # Ensure all queued ops on MPS are complete before next step
|
||
|
|
|
||
|
|
# Timed inference loop
|
||
|
|
tic = time.time()
|
||
|
|
for _ in range(steps):
|
||
|
|
outputs = model(input_ids=input_ids, attention_mask=attention_mask)
|
||
|
|
torch.mps.synchronize() # Wait for computation to finish before timing next iteration
|
||
|
|
toc = time.time()
|
||
|
|
|
||
|
|
# Compute performance metrics
|
||
|
|
ms_per_step = 1000 * (toc - tic) / steps
|
||
|
|
throughput = batch_size * 1000 / ms_per_step
|
||
|
|
|
||
|
|
# Report results
|
||
|
|
print(f"Time (ms) per step: {ms_per_step:.3f}")
|
||
|
|
print(f"Throughput: {throughput:.2f} sequences/sec")
|