Files
mlx-examples/esm/test.py

122 lines
4.9 KiB
Python
Raw Normal View History

2025-08-15 23:48:57 -04:00
import unittest
2025-08-15 23:54:53 -04:00
2025-08-15 23:48:57 -04:00
import numpy as np
2025-08-15 23:54:53 -04:00
from transformers import AutoTokenizer, EsmConfig, EsmForMaskedLM
2025-08-15 23:48:57 -04:00
from esm import ESM2
# Paths for MLX and Hugging Face versions of ESM-2
MLX_PATH = "checkpoints/mlx-esm2_t12_35M_UR50D"
HF_PATH = "facebook/esm2_t12_35M_UR50D"
2025-08-15 23:54:53 -04:00
2025-08-15 23:48:57 -04:00
def load_mlx_model():
"""Load MLX ESM-2 model and tokenizer."""
tokenizer, model = ESM2.from_pretrained(MLX_PATH)
return tokenizer, model
2025-08-15 23:54:53 -04:00
2025-08-15 23:48:57 -04:00
def load_hf_model():
"""Load Hugging Face ESM-2 model and tokenizer with hidden states + attentions."""
tokenizer = AutoTokenizer.from_pretrained(HF_PATH)
config = EsmConfig.from_pretrained(
2025-08-15 23:54:53 -04:00
HF_PATH, output_hidden_states=True, output_attentions=True
2025-08-15 23:48:57 -04:00
)
model = EsmForMaskedLM.from_pretrained(HF_PATH, config=config)
return tokenizer, model
2025-08-15 23:54:53 -04:00
2025-08-15 23:48:57 -04:00
class TestESM2(unittest.TestCase):
@classmethod
def setUpClass(cls):
# Load both MLX and HF models/tokenizers once for all tests
cls.mlx_tokenizer, cls.mlx_model = load_mlx_model()
cls.hf_tokenizer, cls.hf_model = load_hf_model()
2025-08-15 23:54:53 -04:00
2025-08-15 23:48:57 -04:00
def test_tokenizer(self):
"""Verify MLX tokenizer matches Hugging Face tokenizer behavior."""
self.assertEqual(len(self.mlx_tokenizer), len(self.hf_tokenizer))
sequences = [
"MSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVTTFSYGVQCFSRYPDHMKQHDFFKSAMPEGYVQERTIFFKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYNSHNVYIMADKQKNGIKVNFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSTQSALSKDPNEKRDHMVLLEFVTAAGITHGMDELYK",
2025-08-15 23:54:53 -04:00
"MALWMRLLPLLALLALWGPDPAAAFVNQHLCGSHLVEALYLVCGERGFFYTPKTRREAEDLQVGQVELGGGPGAGSLQPLALEGSLQKRGIVEQCCTSICSLYQLENYCN",
2025-08-15 23:48:57 -04:00
]
# Compare batched tokenization (padded sequences)
mlx_batch = self.mlx_tokenizer.batch_encode(sequences)
2025-08-15 23:54:53 -04:00
hf_batch = (
self.hf_tokenizer(sequences, return_tensors="pt", padding=True)["input_ids"]
.cpu()
.numpy()
)
2025-08-15 23:48:57 -04:00
self.assertEqual(tuple(mlx_batch.shape), tuple(hf_batch.shape))
self.assertTrue(
np.array_equal(np.array(mlx_batch.tolist(), dtype=hf_batch.dtype), hf_batch)
)
2025-08-15 23:54:53 -04:00
2025-08-15 23:48:57 -04:00
# Compare single-sequence encode/decode
for sequence in sequences:
mlx_tokens = self.mlx_tokenizer.encode(sequence)
2025-08-15 23:54:53 -04:00
hf_tokens = (
self.hf_tokenizer(sequence, return_tensors="pt")["input_ids"]
.cpu()
.numpy()
.tolist()[0]
)
2025-08-15 23:48:57 -04:00
self.assertTrue(np.array_equal(mlx_tokens, hf_tokens))
self.assertEqual(
self.mlx_tokenizer.decode(mlx_tokens),
2025-08-15 23:54:53 -04:00
self.hf_tokenizer.decode(hf_tokens).replace(" ", ""),
2025-08-15 23:48:57 -04:00
)
self.assertEqual(
self.mlx_tokenizer.decode(mlx_tokens, skip_special_tokens=True),
2025-08-15 23:54:53 -04:00
self.hf_tokenizer.decode(hf_tokens, skip_special_tokens=True).replace(
" ", ""
),
2025-08-15 23:48:57 -04:00
)
def test_model(self):
"""Verify MLX and HF model outputs match (logits, hidden states, attentions)."""
sequences = [
"MSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVTTFSYGVQCFSRYPDHMKQHDFFKSAMPEGYVQERTIFFKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYNSHNVYIMADKQKNGIKVNFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSTQSALSKDPNEKRDHMVLLEFVTAAGITHGMDELYK",
2025-08-15 23:54:53 -04:00
"MALWMRLLPLLALLALWGPDPAAAFVNQHLCGSHLVEALYLVCGERGFFYTPKTRREAEDLQVGQVELGGGPGAGSLQPLALEGSLQKRGIVEQCCTSICSLYQLENYCN",
2025-08-15 23:48:57 -04:00
]
for sequence in sequences:
# Tokenize
mlx_tokens = self.mlx_tokenizer.encode(sequence, return_batch_dim=True)
hf_tokens = self.hf_tokenizer(sequence, return_tensors="pt")["input_ids"]
# Forward pass
mlx_outputs = self.mlx_model(
2025-08-15 23:54:53 -04:00
mlx_tokens,
repr_layers=[self.mlx_model.num_layers],
need_head_weights=True,
2025-08-15 23:48:57 -04:00
)
hf_outputs = self.hf_model(input_ids=hf_tokens)
# Compare logits
mlx_logits = np.array(mlx_outputs["logits"])
hf_logits = hf_outputs["logits"].detach().cpu().numpy()
self.assertTrue(np.allclose(mlx_logits, hf_logits, rtol=1e-4, atol=1e-4))
# Compare final-layer hidden states
final_layer = self.mlx_model.num_layers
mlx_hidden_states = np.array(mlx_outputs["representations"][final_layer])
hf_hidden_states = hf_outputs["hidden_states"][-1].detach().cpu().numpy()
2025-08-15 23:54:53 -04:00
self.assertTrue(
np.allclose(mlx_hidden_states, hf_hidden_states, rtol=1e-4, atol=1e-4)
)
2025-08-15 23:48:57 -04:00
# Compare attentions for final layer
2025-08-15 23:54:53 -04:00
mlx_attentions = np.array(
mlx_outputs["attentions"][:, final_layer - 1, :, :, :]
)
2025-08-15 23:48:57 -04:00
hf_attentions = hf_outputs["attentions"][-1].detach().cpu().numpy()
2025-08-15 23:54:53 -04:00
self.assertTrue(
np.allclose(mlx_attentions, hf_attentions, rtol=1e-4, atol=1e-4)
)
2025-08-15 23:48:57 -04:00
if __name__ == "__main__":
unittest.main()