2025-08-15 23:48:57 -04:00
|
|
|
import unittest
|
2025-08-15 23:54:53 -04:00
|
|
|
|
2025-08-15 23:48:57 -04:00
|
|
|
import numpy as np
|
2025-08-15 23:54:53 -04:00
|
|
|
from transformers import AutoTokenizer, EsmConfig, EsmForMaskedLM
|
2025-08-15 23:48:57 -04:00
|
|
|
|
|
|
|
|
from esm import ESM2
|
|
|
|
|
|
|
|
|
|
# Paths for MLX and Hugging Face versions of ESM-2
|
|
|
|
|
MLX_PATH = "checkpoints/mlx-esm2_t12_35M_UR50D"
|
|
|
|
|
HF_PATH = "facebook/esm2_t12_35M_UR50D"
|
|
|
|
|
|
2025-08-15 23:54:53 -04:00
|
|
|
|
2025-08-15 23:48:57 -04:00
|
|
|
def load_mlx_model():
|
|
|
|
|
"""Load MLX ESM-2 model and tokenizer."""
|
|
|
|
|
tokenizer, model = ESM2.from_pretrained(MLX_PATH)
|
|
|
|
|
return tokenizer, model
|
|
|
|
|
|
2025-08-15 23:54:53 -04:00
|
|
|
|
2025-08-15 23:48:57 -04:00
|
|
|
def load_hf_model():
|
|
|
|
|
"""Load Hugging Face ESM-2 model and tokenizer with hidden states + attentions."""
|
|
|
|
|
tokenizer = AutoTokenizer.from_pretrained(HF_PATH)
|
|
|
|
|
config = EsmConfig.from_pretrained(
|
2025-08-15 23:54:53 -04:00
|
|
|
HF_PATH, output_hidden_states=True, output_attentions=True
|
2025-08-15 23:48:57 -04:00
|
|
|
)
|
|
|
|
|
model = EsmForMaskedLM.from_pretrained(HF_PATH, config=config)
|
|
|
|
|
return tokenizer, model
|
|
|
|
|
|
2025-08-15 23:54:53 -04:00
|
|
|
|
2025-08-15 23:48:57 -04:00
|
|
|
class TestESM2(unittest.TestCase):
|
|
|
|
|
@classmethod
|
|
|
|
|
def setUpClass(cls):
|
|
|
|
|
# Load both MLX and HF models/tokenizers once for all tests
|
|
|
|
|
cls.mlx_tokenizer, cls.mlx_model = load_mlx_model()
|
|
|
|
|
cls.hf_tokenizer, cls.hf_model = load_hf_model()
|
2025-08-15 23:54:53 -04:00
|
|
|
|
2025-08-15 23:48:57 -04:00
|
|
|
def test_tokenizer(self):
|
|
|
|
|
"""Verify MLX tokenizer matches Hugging Face tokenizer behavior."""
|
|
|
|
|
self.assertEqual(len(self.mlx_tokenizer), len(self.hf_tokenizer))
|
|
|
|
|
|
|
|
|
|
sequences = [
|
|
|
|
|
"MSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVTTFSYGVQCFSRYPDHMKQHDFFKSAMPEGYVQERTIFFKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYNSHNVYIMADKQKNGIKVNFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSTQSALSKDPNEKRDHMVLLEFVTAAGITHGMDELYK",
|
2025-08-15 23:54:53 -04:00
|
|
|
"MALWMRLLPLLALLALWGPDPAAAFVNQHLCGSHLVEALYLVCGERGFFYTPKTRREAEDLQVGQVELGGGPGAGSLQPLALEGSLQKRGIVEQCCTSICSLYQLENYCN",
|
2025-08-15 23:48:57 -04:00
|
|
|
]
|
|
|
|
|
|
|
|
|
|
# Compare batched tokenization (padded sequences)
|
|
|
|
|
mlx_batch = self.mlx_tokenizer.batch_encode(sequences)
|
2025-08-15 23:54:53 -04:00
|
|
|
hf_batch = (
|
|
|
|
|
self.hf_tokenizer(sequences, return_tensors="pt", padding=True)["input_ids"]
|
|
|
|
|
.cpu()
|
|
|
|
|
.numpy()
|
|
|
|
|
)
|
2025-08-15 23:48:57 -04:00
|
|
|
self.assertEqual(tuple(mlx_batch.shape), tuple(hf_batch.shape))
|
|
|
|
|
self.assertTrue(
|
|
|
|
|
np.array_equal(np.array(mlx_batch.tolist(), dtype=hf_batch.dtype), hf_batch)
|
|
|
|
|
)
|
2025-08-15 23:54:53 -04:00
|
|
|
|
2025-08-15 23:48:57 -04:00
|
|
|
# Compare single-sequence encode/decode
|
|
|
|
|
for sequence in sequences:
|
|
|
|
|
mlx_tokens = self.mlx_tokenizer.encode(sequence)
|
2025-08-15 23:54:53 -04:00
|
|
|
hf_tokens = (
|
|
|
|
|
self.hf_tokenizer(sequence, return_tensors="pt")["input_ids"]
|
|
|
|
|
.cpu()
|
|
|
|
|
.numpy()
|
|
|
|
|
.tolist()[0]
|
|
|
|
|
)
|
2025-08-15 23:48:57 -04:00
|
|
|
self.assertTrue(np.array_equal(mlx_tokens, hf_tokens))
|
|
|
|
|
self.assertEqual(
|
|
|
|
|
self.mlx_tokenizer.decode(mlx_tokens),
|
2025-08-15 23:54:53 -04:00
|
|
|
self.hf_tokenizer.decode(hf_tokens).replace(" ", ""),
|
2025-08-15 23:48:57 -04:00
|
|
|
)
|
|
|
|
|
self.assertEqual(
|
|
|
|
|
self.mlx_tokenizer.decode(mlx_tokens, skip_special_tokens=True),
|
2025-08-15 23:54:53 -04:00
|
|
|
self.hf_tokenizer.decode(hf_tokens, skip_special_tokens=True).replace(
|
|
|
|
|
" ", ""
|
|
|
|
|
),
|
2025-08-15 23:48:57 -04:00
|
|
|
)
|
|
|
|
|
|
|
|
|
|
def test_model(self):
|
|
|
|
|
"""Verify MLX and HF model outputs match (logits, hidden states, attentions)."""
|
|
|
|
|
sequences = [
|
|
|
|
|
"MSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVTTFSYGVQCFSRYPDHMKQHDFFKSAMPEGYVQERTIFFKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYNSHNVYIMADKQKNGIKVNFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSTQSALSKDPNEKRDHMVLLEFVTAAGITHGMDELYK",
|
2025-08-15 23:54:53 -04:00
|
|
|
"MALWMRLLPLLALLALWGPDPAAAFVNQHLCGSHLVEALYLVCGERGFFYTPKTRREAEDLQVGQVELGGGPGAGSLQPLALEGSLQKRGIVEQCCTSICSLYQLENYCN",
|
2025-08-15 23:48:57 -04:00
|
|
|
]
|
|
|
|
|
for sequence in sequences:
|
|
|
|
|
# Tokenize
|
|
|
|
|
mlx_tokens = self.mlx_tokenizer.encode(sequence, return_batch_dim=True)
|
|
|
|
|
hf_tokens = self.hf_tokenizer(sequence, return_tensors="pt")["input_ids"]
|
|
|
|
|
|
|
|
|
|
# Forward pass
|
|
|
|
|
mlx_outputs = self.mlx_model(
|
2025-08-15 23:54:53 -04:00
|
|
|
mlx_tokens,
|
|
|
|
|
repr_layers=[self.mlx_model.num_layers],
|
|
|
|
|
need_head_weights=True,
|
2025-08-15 23:48:57 -04:00
|
|
|
)
|
|
|
|
|
hf_outputs = self.hf_model(input_ids=hf_tokens)
|
|
|
|
|
|
|
|
|
|
# Compare logits
|
|
|
|
|
mlx_logits = np.array(mlx_outputs["logits"])
|
|
|
|
|
hf_logits = hf_outputs["logits"].detach().cpu().numpy()
|
|
|
|
|
self.assertTrue(np.allclose(mlx_logits, hf_logits, rtol=1e-4, atol=1e-4))
|
|
|
|
|
|
|
|
|
|
# Compare final-layer hidden states
|
|
|
|
|
final_layer = self.mlx_model.num_layers
|
|
|
|
|
mlx_hidden_states = np.array(mlx_outputs["representations"][final_layer])
|
|
|
|
|
hf_hidden_states = hf_outputs["hidden_states"][-1].detach().cpu().numpy()
|
2025-08-15 23:54:53 -04:00
|
|
|
self.assertTrue(
|
|
|
|
|
np.allclose(mlx_hidden_states, hf_hidden_states, rtol=1e-4, atol=1e-4)
|
|
|
|
|
)
|
2025-08-15 23:48:57 -04:00
|
|
|
|
|
|
|
|
# Compare attentions for final layer
|
2025-08-15 23:54:53 -04:00
|
|
|
mlx_attentions = np.array(
|
|
|
|
|
mlx_outputs["attentions"][:, final_layer - 1, :, :, :]
|
|
|
|
|
)
|
2025-08-15 23:48:57 -04:00
|
|
|
hf_attentions = hf_outputs["attentions"][-1].detach().cpu().numpy()
|
2025-08-15 23:54:53 -04:00
|
|
|
self.assertTrue(
|
|
|
|
|
np.allclose(mlx_attentions, hf_attentions, rtol=1e-4, atol=1e-4)
|
|
|
|
|
)
|
|
|
|
|
|
2025-08-15 23:48:57 -04:00
|
|
|
|
|
|
|
|
if __name__ == "__main__":
|
|
|
|
|
unittest.main()
|