2025-08-15 23:48:57 -04:00
|
|
|
import sys
|
|
|
|
|
import time
|
|
|
|
|
from pathlib import Path
|
|
|
|
|
|
|
|
|
|
import mlx.core as mx
|
|
|
|
|
|
|
|
|
|
# Add parent directory to Python path
|
|
|
|
|
cur_path = Path(__file__).parents[1].resolve()
|
|
|
|
|
sys.path.append(str(cur_path))
|
|
|
|
|
|
|
|
|
|
from esm import ESM2
|
|
|
|
|
|
|
|
|
|
# Example protein sequence (Green Fluorescent Protein)
|
|
|
|
|
protein_sequence = "MSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVTTFSYGVQCFSRYPDHMKQHDFFKSAMPEGYVQERTIFFKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYNSHNVYIMADKQKNGIKVNFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSTQSALSKDPNEKRDHMVLLEFVTAAGITHGMDELYK"
|
|
|
|
|
|
|
|
|
|
# Load pretrained ESM-2 model and its tokenizer from local checkpoint
|
|
|
|
|
tokenizer, model = ESM2.from_pretrained("checkpoints/mlx-esm2_t33_650M_UR50D")
|
|
|
|
|
|
|
|
|
|
# Number of sequences to process in each forward pass
|
|
|
|
|
batch_size = 5
|
|
|
|
|
|
|
|
|
|
# Number of timing iterations for performance measurement
|
|
|
|
|
steps = 50
|
|
|
|
|
|
|
|
|
|
# Tokenize the protein sequence into integer IDs for the model
|
|
|
|
|
# Replicate the same sequence 'batch_size' times to create a batch
|
|
|
|
|
tokens = tokenizer.batch_encode([protein_sequence] * batch_size)
|
|
|
|
|
|
|
|
|
|
# Warm-up phase
|
|
|
|
|
for _ in range(10):
|
|
|
|
|
result = model(tokens)
|
|
|
|
|
mx.eval(result["logits"]) # Force computation to complete
|
|
|
|
|
|
|
|
|
|
# Measure average inference time over 'steps' iterations
|
|
|
|
|
tic = time.time()
|
|
|
|
|
for _ in range(steps):
|
|
|
|
|
result = model(tokens)
|
|
|
|
|
mx.eval(result["logits"]) # Synchronize and ensure computation finishes
|
|
|
|
|
toc = time.time()
|
|
|
|
|
|
|
|
|
|
# Compute metrics: average time per step (ms) and throughput (sequences/sec)
|
|
|
|
|
ms_per_step = 1000 * (toc - tic) / steps
|
|
|
|
|
throughput = batch_size * 1000 / ms_per_step
|
|
|
|
|
|
|
|
|
|
# Display results
|
|
|
|
|
print(f"Time (ms) per step: {ms_per_step:.3f}")
|
2025-08-15 23:54:53 -04:00
|
|
|
print(f"Throughput: {throughput:.2f} sequences/sec")
|