2 Commits

Author SHA1 Message Date
Awni Hannun
97939cc86e nits 2024-06-13 07:47:56 -07:00
Awni Hannun
7c6ced183d openlm 2024-06-13 07:47:16 -07:00
183 changed files with 11014 additions and 15585 deletions

View File

@@ -17,6 +17,30 @@ jobs:
pre-commit run --all
if ! git diff --quiet; then echo 'Style checks failed, please install pre-commit and run pre-commit run --all and push the change'; exit 1; fi
mlx_lm_build_and_test:
macos:
xcode: "15.2.0"
resource_class: macos.m1.large.gen1
steps:
- checkout
- run:
name: Install dependencies
command: |
brew install python@3.8
python3.8 -m venv env
source env/bin/activate
pip install --upgrade pip
pip install unittest-xml-reporting
cd llms/
pip install -e .
- run:
name: Run Python tests
command: |
source env/bin/activate
python -m xmlrunner discover -v llms/tests -o test-results/
- store_test_results:
path: test-results
workflows:
build_and_test:
when:
@@ -24,6 +48,7 @@ workflows:
pattern: "^(?!pull/)[-\\w]+$"
value: << pipeline.git.branch >>
jobs:
- mlx_lm_build_and_test
- linux_build_and_test
prb:
@@ -36,5 +61,7 @@ workflows:
type: approval
- apple/authenticate:
context: pr-approval
- mlx_lm_build_and_test:
requires: [ hold ]
- linux_build_and_test:
requires: [ hold ]

3
.gitignore vendored
View File

@@ -6,9 +6,6 @@ __pycache__/
# C extensions
*.so
# Vim
*.swp
# Distribution / packaging
.Python
build/

View File

@@ -1,10 +1,10 @@
repos:
- repo: https://github.com/psf/black-pre-commit-mirror
rev: 25.1.0
rev: 24.3.0
hooks:
- id: black
- repo: https://github.com/pycqa/isort
rev: 6.0.0
rev: 5.13.2
hooks:
- id: isort
args:

View File

@@ -14,4 +14,3 @@ MLX Examples was developed with contributions from the following individuals:
- Markus Enzweiler: Added the `cvae` examples.
- Prince Canuma: Helped add support for `Starcoder2` models.
- Shiyu Li: Added the `Segment Anything Model`.
- Gökdeniz Gülmez: Added support for `MiniCPM`, `Helium`, `Mamba version 1`, `OLMoE` archtectures and support for `full-fine-tuning`.

View File

@@ -4,12 +4,12 @@ This repo contains a variety of standalone examples using the [MLX
framework](https://github.com/ml-explore/mlx).
The [MNIST](mnist) example is a good starting point to learn how to use MLX.
Some more useful examples are listed below. Check-out [MLX
LM](https://github.com/ml-explore/mlx-lm) for a more fully featured Python
package for LLMs with MLX.
Some more useful examples are listed below.
### Text Models
- [MLX LM](llms/README.md) a package for LLM text generation, fine-tuning, and more.
- [Transformer language model](transformer_lm) training.
- Minimal examples of large scale text generation with [LLaMA](llms/llama),
[Mistral](llms/mistral), and more in the [LLMs](llms) directory.
@@ -20,23 +20,18 @@ package for LLMs with MLX.
### Image Models
- Generating images
- [FLUX](flux)
- [Stable Diffusion or SDXL](stable_diffusion)
- Image classification using [ResNets on CIFAR-10](cifar).
- Generating images with [Stable Diffusion or SDXL](stable_diffusion).
- Convolutional variational autoencoder [(CVAE) on MNIST](cvae).
### Audio Models
- Speech recognition with [OpenAI's Whisper](whisper).
- Audio compression and generation with [Meta's EnCodec](encodec).
- Music generation with [Meta's MusicGen](musicgen).
### Multimodal models
- Joint text and image embeddings with [CLIP](clip).
- Text generation from image and text inputs with [LLaVA](llava).
- Image segmentation with [Segment Anything (SAM)](segment_anything).
### Other Models
@@ -46,7 +41,7 @@ package for LLMs with MLX.
### Hugging Face
You can directly use or download converted checkpoints from the [MLX
Note: You can now directly download a few converted checkpoints from the [MLX
Community](https://huggingface.co/mlx-community) organization on Hugging Face.
We encourage you to join the community and [contribute new
models](https://github.com/ml-explore/mlx-examples/issues/155).

View File

@@ -48,17 +48,3 @@ Note this was run on an M1 Macbook Pro with 16GB RAM.
At the time of writing, `mlx` doesn't have built-in learning rate schedules.
We intend to update this example once these features are added.
## Distributed training
The example also supports distributed data parallel training. You can launch a
distributed training as follows:
```shell
$ cat >hostfile.json
[
{"ssh": "host-to-ssh-to", "ips": ["ip-to-bind-to"]},
{"ssh": "host-to-ssh-to", "ips": ["ip-to-bind-to"]}
]
$ mlx.launch --verbose --hostfile hostfile.json main.py --batch 256 --epochs 5 --arch resnet20
```

View File

@@ -1,4 +1,3 @@
import mlx.core as mx
import numpy as np
from mlx.data.datasets import load_cifar10
@@ -13,11 +12,8 @@ def get_cifar10(batch_size, root=None):
x = x.astype("float32") / 255.0
return (x - mean) / std
group = mx.distributed.init()
tr_iter = (
tr.shuffle()
.partition_if(group.size() > 1, group.size(), group.rank())
.to_stream()
.image_random_h_flip("image", prob=0.5)
.pad("image", 0, 4, 4, 0.0)
@@ -29,11 +25,6 @@ def get_cifar10(batch_size, root=None):
)
test = load_cifar10(root=root, train=False)
test_iter = (
test.to_stream()
.partition_if(group.size() > 1, group.size(), group.rank())
.key_transform("image", normalize)
.batch(batch_size)
)
test_iter = test.to_stream().key_transform("image", normalize).batch(batch_size)
return tr_iter, test_iter

View File

@@ -23,13 +23,6 @@ parser.add_argument("--seed", type=int, default=0, help="random seed")
parser.add_argument("--cpu", action="store_true", help="use cpu only")
def print_zero(group, *args, **kwargs):
if group.rank() != 0:
return
flush = kwargs.pop("flush", True)
print(*args, **kwargs, flush=flush)
def eval_fn(model, inp, tgt):
return mx.mean(mx.argmax(model(inp), axis=1) == tgt)
@@ -41,20 +34,9 @@ def train_epoch(model, train_iter, optimizer, epoch):
acc = mx.mean(mx.argmax(output, axis=1) == tgt)
return loss, acc
world = mx.distributed.init()
losses = 0
accuracies = 0
samples_per_sec = 0
count = 0
def average_stats(stats, count):
if world.size() == 1:
return [s / count for s in stats]
with mx.stream(mx.cpu):
stats = mx.distributed.all_sum(mx.array(stats))
count = mx.distributed.all_sum(count)
return (stats / count).tolist()
losses = []
accs = []
samples_per_sec = []
state = [model.state, optimizer.state]
@@ -62,7 +44,6 @@ def train_epoch(model, train_iter, optimizer, epoch):
def step(inp, tgt):
train_step_fn = nn.value_and_grad(model, train_step)
(loss, acc), grads = train_step_fn(model, inp, tgt)
grads = nn.utils.average_gradients(grads)
optimizer.update(model, grads)
return loss, acc
@@ -71,79 +52,69 @@ def train_epoch(model, train_iter, optimizer, epoch):
y = mx.array(batch["label"])
tic = time.perf_counter()
loss, acc = step(x, y)
mx.eval(loss, acc, state)
mx.eval(state)
toc = time.perf_counter()
losses += loss.item()
accuracies += acc.item()
samples_per_sec += x.shape[0] / (toc - tic)
count += 1
loss = loss.item()
acc = acc.item()
losses.append(loss)
accs.append(acc)
throughput = x.shape[0] / (toc - tic)
samples_per_sec.append(throughput)
if batch_counter % 10 == 0:
l, a, s = average_stats(
[losses, accuracies, world.size() * samples_per_sec],
count,
)
print_zero(
world,
print(
" | ".join(
(
f"Epoch {epoch:02d} [{batch_counter:03d}]",
f"Train loss {l:.3f}",
f"Train acc {a:.3f}",
f"Throughput: {s:.2f} images/second",
f"Train loss {loss:.3f}",
f"Train acc {acc:.3f}",
f"Throughput: {throughput:.2f} images/second",
)
),
)
)
return average_stats([losses, accuracies, world.size() * samples_per_sec], count)
mean_tr_loss = mx.mean(mx.array(losses))
mean_tr_acc = mx.mean(mx.array(accs))
samples_per_sec = mx.mean(mx.array(samples_per_sec))
return mean_tr_loss, mean_tr_acc, samples_per_sec
def test_epoch(model, test_iter, epoch):
accuracies = 0
count = 0
accs = []
for batch_counter, batch in enumerate(test_iter):
x = mx.array(batch["image"])
y = mx.array(batch["label"])
acc = eval_fn(model, x, y)
accuracies += acc.item()
count += 1
with mx.stream(mx.cpu):
accuracies = mx.distributed.all_sum(accuracies)
count = mx.distributed.all_sum(count)
return (accuracies / count).item()
acc_value = acc.item()
accs.append(acc_value)
mean_acc = mx.mean(mx.array(accs))
return mean_acc
def main(args):
mx.random.seed(args.seed)
# Initialize the distributed group and report the nodes that showed up
world = mx.distributed.init()
if world.size() > 1:
print(f"Starting rank {world.rank()} of {world.size()}", flush=True)
model = getattr(resnet, args.arch)()
print_zero(world, f"Number of params: {model.num_params() / 1e6:0.04f} M")
print("Number of params: {:0.04f} M".format(model.num_params() / 1e6))
optimizer = optim.Adam(learning_rate=args.lr)
train_data, test_data = get_cifar10(args.batch_size)
for epoch in range(args.epochs):
tr_loss, tr_acc, throughput = train_epoch(model, train_data, optimizer, epoch)
print_zero(
world,
print(
" | ".join(
(
f"Epoch: {epoch}",
f"avg. Train loss {tr_loss:.3f}",
f"avg. Train acc {tr_acc:.3f}",
f"Throughput: {throughput:.2f} images/sec",
f"avg. Train loss {tr_loss.item():.3f}",
f"avg. Train acc {tr_acc.item():.3f}",
f"Throughput: {throughput.item():.2f} images/sec",
)
),
)
)
test_acc = test_epoch(model, test_data, epoch)
print_zero(world, f"Epoch: {epoch} | Test acc {test_acc:.3f}")
print(f"Epoch: {epoch} | Test acc {test_acc.item():.3f}")
train_data.reset()
test_data.reset()

View File

@@ -63,7 +63,7 @@ def save_weights(save_path: Union[str, Path], weights: Dict[str, Any]) -> None:
)
def get_model_path(path_or_hf_repo: str, force_download: bool = False) -> Path:
def get_model_path(path_or_hf_repo: str) -> Path:
model_path = Path(path_or_hf_repo)
if not model_path.exists():
model_path = Path(
@@ -74,7 +74,6 @@ def get_model_path(path_or_hf_repo: str, force_download: bool = False) -> Path:
"*.json",
"*.txt",
],
force_download=force_download,
)
)
return model_path
@@ -108,20 +107,14 @@ if __name__ == "__main__":
type=str,
default="float32",
)
parser.add_argument(
"-f",
"--force-download",
help="Force download the model from Hugging Face.",
action="store_true",
)
args = parser.parse_args()
torch_path = get_model_path(args.hf_repo, args.force_download)
torch_path = get_model_path(args.hf_repo)
mlx_path = Path(args.mlx_path)
mlx_path.mkdir(parents=True, exist_ok=True)
print("[INFO] Loading")
torch_weights = torch.load(torch_path / "pytorch_model.bin", weights_only=True)
torch_weights = torch.load(torch_path / "pytorch_model.bin")
print("[INFO] Converting")
mlx_weights = {
k: torch_to_mx(v, dtype=args.dtype) for k, v in torch_weights.items()

View File

@@ -1,56 +0,0 @@
# Mirror of the Linear Probe Evaluation Script
# from the official CLIP Repository.
import mlx.core as mx
import numpy as np
from image_processor import CLIPImageProcessor
from mlx.data.datasets import load_cifar10
from model import CLIPModel
from PIL import Image
from sklearn.linear_model import LogisticRegression
from tqdm import tqdm
def get_cifar10(batch_size, root=None):
tr = load_cifar10(root=root).batch(batch_size)
test = load_cifar10(root=root, train=False).batch(batch_size)
return tr, test
def get_features(model, image_proc, iter):
all_features = []
all_labels = []
for batch in tqdm(iter):
image, label = batch["image"], batch["label"]
x = image_proc([Image.fromarray(im) for im in image])
y = mx.array(label)
image_embeds = model.get_image_features(x)
mx.eval(image_embeds)
all_features.append(image_embeds)
all_labels.append(y)
return mx.concatenate(all_features), mx.concatenate(all_labels)
if __name__ == "__main__":
model = CLIPModel.from_pretrained("mlx_model")
image_proc = CLIPImageProcessor.from_pretrained("mlx_model")
train_iter, test_iter = get_cifar10(batch_size=256)
train_features, train_labels = get_features(model, image_proc, train_iter)
test_features, test_labels = get_features(model, image_proc, test_iter)
# Perform logistic regression
# NOTE: The value of C should be determined via a hyperparameter sweep
# using a validation split
classifier = LogisticRegression(random_state=0, C=0.316, max_iter=1000, verbose=1)
classifier.fit(train_features, train_labels)
# Evaluate using the logistic regression classifier
predictions = classifier.predict(test_features)
accuracy = (test_labels.squeeze() == predictions).mean().item() * 100
print(f"Accuracy = {accuracy:.3f}")

View File

@@ -1,5 +1,4 @@
mlx
mlx-data
numpy
transformers
torch

View File

@@ -1,84 +0,0 @@
# EnCodec
An example of Meta's EnCodec model in MLX.[^1] EnCodec is used to compress and
generate audio.
### Setup
Install the requirements:
```
pip install -r requirements.txt
```
Optionally install FFmpeg and SciPy for loading and saving audio files,
respectively.
Install [FFmpeg](https://ffmpeg.org/):
```
# on macOS using Homebrew (https://brew.sh/)
brew install ffmpeg
```
Install SciPy:
```
pip install scipy
```
### Example
An example using the model:
```python
import mlx.core as mx
from encodec import EncodecModel
from utils import load_audio, save_audio
# Load the 48 KHz model and preprocessor.
model, processor = EncodecModel.from_pretrained("mlx-community/encodec-48khz-float32")
# Load an audio file
audio = load_audio("path/to/audio", model.sampling_rate, model.channels)
# Preprocess the audio (this can also be a list of arrays for batched
# processing).
feats, mask = processor(audio)
# Encode at the given bandwidth. A lower bandwidth results in more
# compression but lower reconstruction quality.
@mx.compile
def encode(feats, mask):
return model.encode(feats, mask, bandwidth=3)
# Decode to reconstruct the audio
@mx.compile
def decode(codes, scales, mask):
return model.decode(codes, scales, mask)
codes, scales = encode(feats, mask)
reconstructed = decode(codes, scales, mask)
# Trim any padding:
reconstructed = reconstructed[0, : len(audio)]
# Save the audio as a wave file
save_audio("reconstructed.wav", reconstructed, model.sampling_rate)
```
The 24 KHz, 32 KHz, and 48 KHz MLX formatted models are available in the
[Hugging Face MLX Community](https://huggingface.co/collections/mlx-community/encodec-66e62334038300b07a43b164)
in several data types.
### Optional
To convert models, use the `convert.py` script. To see the options, run:
```bash
python convert.py -h
```
[^1]: Refer to the [arXiv paper](https://arxiv.org/abs/2210.13438) and
[code](https://github.com/facebookresearch/encodec) for more details.

View File

@@ -1,31 +0,0 @@
# Copyright © 2024 Apple Inc.
import time
import mlx.core as mx
from encodec import EncodecModel
model, processor = EncodecModel.from_pretrained("mlx-community/encodec-48khz-float32")
audio = mx.random.uniform(shape=(288000, 2))
feats, mask = processor(audio)
mx.eval(model, feats, mask)
@mx.compile
def fun():
codes, scales = model.encode(feats, mask, bandwidth=3)
reconstructed = model.decode(codes, scales, mask)
return reconstructed
for _ in range(5):
mx.eval(fun())
tic = time.time()
for _ in range(10):
mx.eval(fun())
toc = time.time()
ms = 1000 * (toc - tic) / 10
print(f"Time per it: {ms:.3f}")

View File

@@ -1,34 +0,0 @@
# Copyright © 2024 Apple Inc.
import time
import numpy as np
import torch
from transformers import AutoProcessor, EncodecModel
processor = AutoProcessor.from_pretrained("facebook/encodec_48khz")
audio = np.random.uniform(size=(2, 288000)).astype(np.float32)
pt_model = EncodecModel.from_pretrained("facebook/encodec_48khz").to("mps")
pt_inputs = processor(
raw_audio=audio, sampling_rate=processor.sampling_rate, return_tensors="pt"
).to("mps")
def fun():
pt_encoded = pt_model.encode(pt_inputs["input_values"], pt_inputs["padding_mask"])
pt_audio = pt_model.decode(
pt_encoded.audio_codes, pt_encoded.audio_scales, pt_inputs["padding_mask"]
)
torch.mps.synchronize()
for _ in range(5):
fun()
tic = time.time()
for _ in range(10):
fun()
toc = time.time()
ms = 1000 * (toc - tic) / 10
print(f"Time per it: {ms:.3f}")

View File

@@ -1,212 +0,0 @@
# Copyright © 2024 Apple Inc.
import argparse
import json
from pathlib import Path
from textwrap import dedent
from types import SimpleNamespace
from typing import Any, Dict, Union
import mlx.core as mx
import mlx.nn as nn
from huggingface_hub import snapshot_download
import encodec
def fetch_from_hub(hf_repo: str) -> Path:
model_path = Path(
snapshot_download(
repo_id=hf_repo,
allow_patterns=["*.json", "*.safetensors"],
)
)
return model_path
def upload_to_hub(path: str, upload_repo: str, hf_path: str):
"""
Uploads the model to Hugging Face hub.
Args:
path (str): Local path to the model.
upload_repo (str): Name of the HF repo to upload to.
hf_path (str): Path to the original Hugging Face model.
"""
import os
from huggingface_hub import HfApi, ModelCard, logging
content = dedent(
f"""
---
language: en
license: other
library: mlx
tags:
- mlx
---
The Model [{upload_repo}](https://huggingface.co/{upload_repo}) was
converted to MLX format from
[{hf_path}](https://huggingface.co/{hf_path}).
This model is intended to be used with the [EnCodec MLX
example](https://github.com/ml-explore/mlx-examples/tree/main/encodec).
"""
)
card = ModelCard(content)
card.save(os.path.join(path, "README.md"))
logging.set_verbosity_info()
api = HfApi()
api.create_repo(repo_id=upload_repo, exist_ok=True)
api.upload_folder(
folder_path=path,
repo_id=upload_repo,
repo_type="model",
multi_commits=True,
multi_commits_verbose=True,
)
print(f"Upload successful, go to https://huggingface.co/{upload_repo} for details.")
def save_weights(save_path: Union[str, Path], weights: Dict[str, Any]) -> None:
if isinstance(save_path, str):
save_path = Path(save_path)
save_path.mkdir(parents=True, exist_ok=True)
total_size = sum(v.nbytes for v in weights.values())
index_data = {"metadata": {"total_size": total_size}, "weight_map": {}}
mx.save_safetensors(
str(save_path / "model.safetensors"), weights, metadata={"format": "mlx"}
)
for weight_name in weights.keys():
index_data["weight_map"][weight_name] = "model.safetensors"
index_data["weight_map"] = {
k: index_data["weight_map"][k] for k in sorted(index_data["weight_map"])
}
with open(save_path / "model.safetensors.index.json", "w") as f:
json.dump(index_data, f, indent=4)
def save_config(
config: dict,
config_path: Union[str, Path],
) -> None:
"""Save the model configuration to the ``config_path``.
The final configuration will be sorted before saving for better readability.
Args:
config (dict): The model configuration.
config_path (Union[str, Path]): Model configuration file path.
"""
# Clean unused keys
config.pop("_name_or_path", None)
# sort the config for better readability
config = dict(sorted(config.items()))
# write the updated config to the config_path (if provided)
with open(config_path, "w") as fid:
json.dump(config, fid, indent=4)
def convert(
upload: bool,
model: str,
dtype: str = None,
):
hf_repo = f"facebook/encodec_{model}"
mlx_repo = f"mlx-community/encodec-{model}-{dtype}"
path = fetch_from_hub(hf_repo)
save_path = Path("mlx_models")
weights = mx.load(str(Path(path) / "model.safetensors"))
with open(path / "config.json", "r") as fid:
config = SimpleNamespace(**json.load(fid))
model = encodec.EncodecModel(config)
new_weights = {}
for k, v in weights.items():
basename, pname = k.rsplit(".", 1)
if pname == "weight_v":
g = weights[basename + ".weight_g"]
v = g * (v / mx.linalg.norm(v, axis=(1, 2), keepdims=True))
k = basename + ".weight"
elif pname in ["weight_g", "embed_avg", "cluster_size", "inited"]:
continue
elif "lstm" in basename:
w_or_b, ih_or_hh, ln = pname.split("_")
if w_or_b == "weight":
new_pname = "Wx" if ih_or_hh == "ih" else "Wh"
elif w_or_b == "bias" and ih_or_hh == "ih":
continue
else:
v = v + weights[k.replace("_hh_", "_ih_")]
new_pname = "bias"
k = basename + "." + ln[1:] + "." + new_pname
if "conv.weight" in k:
# Possibly a transposed conv which has a different order
if "decoder" in k:
ln = int(k.split(".")[2])
if "conv" in model.decoder.layers[ln] and isinstance(
model.decoder.layers[ln].conv, nn.ConvTranspose1d
):
v = mx.moveaxis(v, 0, 2)
else:
v = mx.moveaxis(v, 1, 2)
else:
v = mx.moveaxis(v, 1, 2)
new_weights[k] = v
weights = new_weights
model.load_weights(list(weights.items()))
if dtype is not None:
t = getattr(mx, dtype)
weights = {k: v.astype(t) for k, v in weights.items()}
if isinstance(save_path, str):
save_path = Path(save_path)
save_weights(save_path, weights)
save_config(vars(config), config_path=save_path / "config.json")
if upload:
upload_to_hub(save_path, mlx_repo, hf_repo)
if __name__ == "__main__":
parser = argparse.ArgumentParser(description="Convert EnCodec weights to MLX.")
parser.add_argument(
"--model",
type=str,
default="48khz",
help="",
choices=["24khz", "32khz", "48khz"],
)
parser.add_argument(
"--upload",
action="store_true",
help="Upload the weights to Hugging Face.",
)
parser.add_argument(
"--dtype",
type=str,
help="Data type to convert the model to.",
default="float32",
choices=["float32", "bfloat16", "float16"],
)
args = parser.parse_args()
convert(upload=args.upload, model=args.model, dtype=args.dtype)

View File

@@ -1,741 +0,0 @@
# Copyright © 2024 Apple Inc.
import functools
import json
import math
from pathlib import Path
from types import SimpleNamespace
from typing import List, Optional, Tuple, Union
import mlx.core as mx
import mlx.nn as nn
import numpy as np
_lstm_kernel = mx.fast.metal_kernel(
name="lstm",
input_names=["x", "h_in", "cell", "hidden_size", "time_step", "num_time_steps"],
output_names=["hidden_state", "cell_state"],
header="""
template <typename T>
T sigmoid(T x) {
auto y = 1 / (1 + metal::exp(-metal::abs(x)));
return (x < 0) ? 1 - y : y;
}
""",
source="""
uint b = thread_position_in_grid.x;
uint d = hidden_size * 4;
uint elem = b * d + thread_position_in_grid.y;
uint index = elem;
uint x_index = b * num_time_steps * d + time_step * d + index;
auto i = sigmoid(h_in[index] + x[x_index]);
index += hidden_size;
x_index += hidden_size;
auto f = sigmoid(h_in[index] + x[x_index]);
index += hidden_size;
x_index += hidden_size;
auto g = metal::precise::tanh(h_in[index] + x[x_index]);
index += hidden_size;
x_index += hidden_size;
auto o = sigmoid(h_in[index] + x[x_index]);
cell_state[elem] = f * cell[elem] + i * g;
hidden_state[elem] = o * metal::precise::tanh(cell_state[elem]);
""",
)
def lstm_custom(x, h_in, cell, time_step):
assert x.ndim == 3, "Input to LSTM must have 3 dimensions."
out_shape = cell.shape
return _lstm_kernel(
inputs=[x, h_in, cell, out_shape[-1], time_step, x.shape[-2]],
output_shapes=[out_shape, out_shape],
output_dtypes=[h_in.dtype, h_in.dtype],
grid=(x.shape[0], h_in.size // 4, 1),
threadgroup=(256, 1, 1),
)
class LSTM(nn.Module):
def __init__(
self,
input_size: int,
hidden_size: int,
bias: bool = True,
):
super().__init__()
self.hidden_size = hidden_size
self.Wx = mx.zeros((4 * hidden_size, input_size))
self.Wh = mx.zeros((4 * hidden_size, hidden_size))
self.bias = mx.zeros((4 * hidden_size,)) if bias else None
def __call__(self, x, hidden=None, cell=None):
if self.bias is not None:
x = mx.addmm(self.bias, x, self.Wx.T)
else:
x = x @ self.Wx.T
all_hidden = []
B = x.shape[0]
cell = cell or mx.zeros((B, self.hidden_size), x.dtype)
for t in range(x.shape[-2]):
if hidden is None:
hidden = mx.zeros((B, self.hidden_size * 4), x.dtype)
else:
hidden = hidden @ self.Wh.T
hidden, cell = lstm_custom(x, hidden, cell, t)
all_hidden.append(hidden)
return mx.stack(all_hidden, axis=-2)
class EncodecConv1d(nn.Module):
"""Conv1d with asymmetric or causal padding and normalization."""
def __init__(
self,
config,
in_channels: int,
out_channels: int,
kernel_size: int,
stride: int = 1,
dilation: int = 1,
):
super().__init__()
self.causal = config.use_causal_conv
self.pad_mode = config.pad_mode
self.norm_type = config.norm_type
self.conv = nn.Conv1d(
in_channels, out_channels, kernel_size, stride, dilation=dilation
)
if self.norm_type == "time_group_norm":
self.norm = nn.GroupNorm(1, out_channels, pytorch_compatible=True)
self.stride = stride
# Effective kernel size with dilations.
self.kernel_size = (kernel_size - 1) * dilation + 1
self.padding_total = kernel_size - stride
def _get_extra_padding_for_conv1d(
self,
hidden_states: mx.array,
) -> mx.array:
length = hidden_states.shape[1]
n_frames = (length - self.kernel_size + self.padding_total) / self.stride + 1
n_frames = int(math.ceil(n_frames)) - 1
ideal_length = n_frames * self.stride + self.kernel_size - self.padding_total
return ideal_length - length
def _pad1d(
self,
hidden_states: mx.array,
paddings: Tuple[int, int],
mode: str = "zero",
value: float = 0.0,
):
if mode != "reflect":
return mx.pad(
hidden_states, paddings, mode="constant", constant_values=value
)
length = hidden_states.shape[1]
prefix = hidden_states[:, 1 : paddings[0] + 1][:, ::-1]
suffix = hidden_states[:, max(length - (paddings[1] + 1), 0) : -1][:, ::-1]
return mx.concatenate([prefix, hidden_states, suffix], axis=1)
def __call__(self, hidden_states):
extra_padding = self._get_extra_padding_for_conv1d(hidden_states)
if self.causal:
# Left padding for causal
hidden_states = self._pad1d(
hidden_states, (self.padding_total, extra_padding), mode=self.pad_mode
)
else:
# Asymmetric padding required for odd strides
padding_right = self.padding_total // 2
padding_left = self.padding_total - padding_right
hidden_states = self._pad1d(
hidden_states,
(padding_left, padding_right + extra_padding),
mode=self.pad_mode,
)
hidden_states = self.conv(hidden_states)
if self.norm_type == "time_group_norm":
hidden_states = self.norm(hidden_states)
return hidden_states
class EncodecConvTranspose1d(nn.Module):
"""ConvTranspose1d with asymmetric or causal padding and normalization."""
def __init__(
self,
config,
in_channels: int,
out_channels: int,
kernel_size: int,
stride: int = 1,
):
super().__init__()
self.causal = config.use_causal_conv
self.trim_right_ratio = config.trim_right_ratio
self.norm_type = config.norm_type
self.conv = nn.ConvTranspose1d(in_channels, out_channels, kernel_size, stride)
if config.norm_type == "time_group_norm":
self.norm = nn.GroupNorm(1, out_channels, pytorch_compatible=True)
self.padding_total = kernel_size - stride
def __call__(self, hidden_states):
hidden_states = self.conv(hidden_states)
if self.norm_type == "time_group_norm":
hidden_states = self.norm(hidden_states)
if self.causal:
padding_right = math.ceil(self.padding_total * self.trim_right_ratio)
else:
padding_right = self.padding_total // 2
padding_left = self.padding_total - padding_right
end = hidden_states.shape[1] - padding_right
hidden_states = hidden_states[:, padding_left:end, :]
return hidden_states
class EncodecLSTM(nn.Module):
def __init__(self, config, dimension):
super().__init__()
self.lstm = [LSTM(dimension, dimension) for _ in range(config.num_lstm_layers)]
def __call__(self, hidden_states):
h = hidden_states
for lstm in self.lstm:
h = lstm(h)
return h + hidden_states
class EncodecResnetBlock(nn.Module):
"""
Residual block from SEANet model as used by EnCodec.
"""
def __init__(self, config, dim: int, dilations: List[int]):
super().__init__()
kernel_sizes = (config.residual_kernel_size, 1)
if len(kernel_sizes) != len(dilations):
raise ValueError("Number of kernel sizes should match number of dilations")
hidden = dim // config.compress
block = []
for i, (kernel_size, dilation) in enumerate(zip(kernel_sizes, dilations)):
in_chs = dim if i == 0 else hidden
out_chs = dim if i == len(kernel_sizes) - 1 else hidden
block += [nn.ELU()]
block += [
EncodecConv1d(config, in_chs, out_chs, kernel_size, dilation=dilation)
]
self.block = block
if getattr(config, "use_conv_shortcut", True):
self.shortcut = EncodecConv1d(config, dim, dim, kernel_size=1)
else:
self.shortcut = nn.Identity()
def __call__(self, hidden_states):
residual = hidden_states
for layer in self.block:
hidden_states = layer(hidden_states)
return self.shortcut(residual) + hidden_states
class EncodecEncoder(nn.Module):
"""SEANet encoder as used by EnCodec."""
def __init__(self, config):
super().__init__()
model = [
EncodecConv1d(
config, config.audio_channels, config.num_filters, config.kernel_size
)
]
scaling = 1
for ratio in reversed(config.upsampling_ratios):
current_scale = scaling * config.num_filters
for j in range(config.num_residual_layers):
model += [
EncodecResnetBlock(
config, current_scale, [config.dilation_growth_rate**j, 1]
)
]
model += [nn.ELU()]
model += [
EncodecConv1d(
config,
current_scale,
current_scale * 2,
kernel_size=ratio * 2,
stride=ratio,
)
]
scaling *= 2
model += [EncodecLSTM(config, scaling * config.num_filters)]
model += [nn.ELU()]
model += [
EncodecConv1d(
config,
scaling * config.num_filters,
config.hidden_size,
config.last_kernel_size,
)
]
self.layers = model
def __call__(self, hidden_states):
for layer in self.layers:
hidden_states = layer(hidden_states)
return hidden_states
class EncodecDecoder(nn.Module):
"""SEANet decoder as used by EnCodec."""
def __init__(self, config):
super().__init__()
scaling = int(2 ** len(config.upsampling_ratios))
model = [
EncodecConv1d(
config,
config.hidden_size,
scaling * config.num_filters,
config.kernel_size,
)
]
model += [EncodecLSTM(config, scaling * config.num_filters)]
for ratio in config.upsampling_ratios:
current_scale = scaling * config.num_filters
model += [nn.ELU()]
model += [
EncodecConvTranspose1d(
config,
current_scale,
current_scale // 2,
kernel_size=ratio * 2,
stride=ratio,
)
]
for j in range(config.num_residual_layers):
model += [
EncodecResnetBlock(
config, current_scale // 2, (config.dilation_growth_rate**j, 1)
)
]
scaling //= 2
model += [nn.ELU()]
model += [
EncodecConv1d(
config,
config.num_filters,
config.audio_channels,
config.last_kernel_size,
)
]
self.layers = model
def __call__(self, hidden_states):
for layer in self.layers:
hidden_states = layer(hidden_states)
return hidden_states
class EncodecEuclideanCodebook(nn.Module):
"""Codebook with Euclidean distance."""
def __init__(self, config):
super().__init__()
self.embed = mx.zeros((config.codebook_size, config.codebook_dim))
def quantize(self, hidden_states):
embed = self.embed.T
scaled_states = hidden_states.square().sum(axis=1, keepdims=True)
dist = -(
scaled_states
- 2 * hidden_states @ embed
+ embed.square().sum(axis=0, keepdims=True)
)
embed_ind = dist.argmax(axis=-1)
return embed_ind
def encode(self, hidden_states):
shape = hidden_states.shape
hidden_states = hidden_states.reshape((-1, shape[-1]))
embed_ind = self.quantize(hidden_states)
embed_ind = embed_ind.reshape(*shape[:-1])
return embed_ind
def decode(self, embed_ind):
return self.embed[embed_ind]
class EncodecVectorQuantization(nn.Module):
"""
Vector quantization implementation. Currently supports only euclidean distance.
"""
def __init__(self, config):
super().__init__()
self.codebook = EncodecEuclideanCodebook(config)
def encode(self, hidden_states):
return self.codebook.encode(hidden_states)
def decode(self, embed_ind):
return self.codebook.decode(embed_ind)
class EncodecResidualVectorQuantizer(nn.Module):
"""Residual Vector Quantizer."""
def __init__(self, config):
super().__init__()
self.codebook_size = config.codebook_size
hop_length = np.prod(config.upsampling_ratios)
self.frame_rate = math.ceil(config.sampling_rate / hop_length)
self.num_quantizers = int(
1000 * config.target_bandwidths[-1] // (self.frame_rate * 10)
)
self.layers = [
EncodecVectorQuantization(config) for _ in range(self.num_quantizers)
]
def get_num_quantizers_for_bandwidth(
self, bandwidth: Optional[float] = None
) -> int:
"""Return num_quantizers based on specified target bandwidth."""
bw_per_q = math.log2(self.codebook_size) * self.frame_rate
num_quantizers = self.num_quantizers
if bandwidth is not None and bandwidth > 0.0:
num_quantizers = int(max(1, math.floor(bandwidth * 1000 / bw_per_q)))
return num_quantizers
def encode(
self, embeddings: mx.array, bandwidth: Optional[float] = None
) -> mx.array:
"""
Encode a given input array with the specified frame rate at the given
bandwidth. The RVQ encode method sets the appropriate number of
quantizers to use and returns indices for each quantizer.
"""
num_quantizers = self.get_num_quantizers_for_bandwidth(bandwidth)
residual = embeddings
all_indices = []
for layer in self.layers[:num_quantizers]:
indices = layer.encode(residual)
quantized = layer.decode(indices)
residual = residual - quantized
all_indices.append(indices)
out_indices = mx.stack(all_indices, axis=1)
return out_indices
def decode(self, codes: mx.array) -> mx.array:
"""Decode the given codes to the quantized representation."""
quantized_out = None
for i, indices in enumerate(codes.split(codes.shape[1], axis=1)):
layer = self.layers[i]
quantized = layer.decode(indices.squeeze(1))
if quantized_out is None:
quantized_out = quantized
else:
quantized_out = quantized + quantized_out
return quantized_out
class EncodecModel(nn.Module):
def __init__(self, config):
super().__init__()
self.config = config
self.encoder = EncodecEncoder(config)
self.decoder = EncodecDecoder(config)
self.quantizer = EncodecResidualVectorQuantizer(config)
def _encode_frame(
self, input_values: mx.array, bandwidth: float, padding_mask: mx.array
) -> Tuple[mx.array, Optional[mx.array]]:
"""
Encodes the given input using the underlying VQVAE.
"""
length = input_values.shape[1]
duration = length / self.config.sampling_rate
if (
self.config.chunk_length_s is not None
and duration > 1e-5 + self.config.chunk_length_s
):
raise RuntimeError(
f"Duration of frame ({duration}) is longer than chunk {self.config.chunk_length_s}"
)
scale = None
if self.config.normalize:
# if the padding is non zero
input_values = input_values * padding_mask[..., None]
mono = mx.sum(input_values, axis=2, keepdims=True) / input_values.shape[2]
scale = mono.square().mean(axis=1, keepdims=True).sqrt() + 1e-8
input_values = input_values / scale
embeddings = self.encoder(input_values)
codes = self.quantizer.encode(embeddings, bandwidth)
return codes, scale
def encode(
self,
input_values: mx.array,
padding_mask: mx.array = None,
bandwidth: Optional[float] = None,
) -> Tuple[mx.array, Optional[mx.array]]:
"""
Encodes the input audio waveform into discrete codes.
Args:
input_values (mx.array): The input audio waveform with shape
``(batch_size, channels, sequence_length)``.
padding_mask (mx.array): Padding mask used to pad the ``input_values``.
bandwidth (float, optional): The target bandwidth. Must be one of
``config.target_bandwidths``. If ``None``, uses the smallest
possible bandwidth. bandwidth is represented as a thousandth of
what it is, e.g. 6kbps bandwidth is represented as bandwidth == 6.0
Returns:
A list of frames containing the discrete encoded codes for the
input audio waveform, along with rescaling factors for each chunk
when ``config.normalize==True``. Each frame is a tuple ``(codebook,
scale)``, with ``codebook`` of shape ``(batch_size, num_codebooks,
frames)``.
"""
if bandwidth is None:
bandwidth = self.config.target_bandwidths[0]
if bandwidth not in self.config.target_bandwidths:
raise ValueError(
f"This model doesn't support the bandwidth {bandwidth}. "
f"Select one of {self.config.target_bandwidths}."
)
_, input_length, channels = input_values.shape
if channels < 1 or channels > 2:
raise ValueError(
f"Number of audio channels must be 1 or 2, but got {channels}"
)
chunk_length = self.chunk_length
if chunk_length is None:
chunk_length = input_length
stride = input_length
else:
stride = self.chunk_stride
if padding_mask is None:
padding_mask = mx.ones(input_values.shape[:2], dtype=mx.bool_)
encoded_frames = []
scales = []
step = chunk_length - stride
if (input_length % stride) != step:
raise ValueError(
"The input length is not properly padded for batched chunked "
"encoding. Make sure to pad the input correctly."
)
for offset in range(0, input_length - step, stride):
mask = padding_mask[:, offset : offset + chunk_length].astype(mx.bool_)
frame = input_values[:, offset : offset + chunk_length]
encoded_frame, scale = self._encode_frame(frame, bandwidth, mask)
encoded_frames.append(encoded_frame)
scales.append(scale)
encoded_frames = mx.stack(encoded_frames)
return (encoded_frames, scales)
@staticmethod
def _linear_overlap_add(frames: List[mx.array], stride: int):
if len(frames) == 0:
raise ValueError("`frames` cannot be an empty list.")
dtype = frames[0].dtype
N, frame_length, C = frames[0].shape
total_size = stride * (len(frames) - 1) + frames[-1].shape[1]
time_vec = mx.linspace(0, 1, frame_length + 2, dtype=dtype)[1:-1]
weight = 0.5 - (time_vec - 0.5).abs()
weight = weight[:, None]
sum_weight = mx.zeros((total_size, 1), dtype=dtype)
out = mx.zeros((N, total_size, C), dtype=dtype)
offset = 0
for frame in frames:
frame_length = frame.shape[1]
out[:, offset : offset + frame_length] += weight[:frame_length] * frame
sum_weight[offset : offset + frame_length] += weight[:frame_length]
offset += stride
return out / sum_weight
def _decode_frame(
self, codes: mx.array, scale: Optional[mx.array] = None
) -> mx.array:
embeddings = self.quantizer.decode(codes)
outputs = self.decoder(embeddings)
if scale is not None:
outputs = outputs * scale
return outputs
@property
def channels(self):
return self.config.audio_channels
@property
def sampling_rate(self):
return self.config.sampling_rate
@property
def chunk_length(self):
if self.config.chunk_length_s is None:
return None
else:
return int(self.config.chunk_length_s * self.config.sampling_rate)
@property
def chunk_stride(self):
if self.config.chunk_length_s is None or self.config.overlap is None:
return None
else:
return max(1, int((1.0 - self.config.overlap) * self.chunk_length))
def decode(
self,
audio_codes: mx.array,
audio_scales: Union[mx.array, List[mx.array]],
padding_mask: Optional[mx.array] = None,
) -> Tuple[mx.array, mx.array]:
"""
Decodes the given frames into an output audio waveform.
Note that the output might be a bit bigger than the input. In that
case, any extra steps at the end should be trimmed.
Args:
audio_codes (mx.array): Discret code embeddings of shape
``(batch_size, nb_chunks, chunk_length)``.
audio_scales (mx.array): Scaling factor for each input.
padding_mask (mx.array): Padding mask.
"""
chunk_length = self.chunk_length
if chunk_length is None:
if audio_codes.shape[1] != 1:
raise ValueError(f"Expected one frame, got {len(audio_codes)}")
audio_values = self._decode_frame(audio_codes[:, 0], audio_scales[0])
else:
decoded_frames = []
for frame, scale in zip(audio_codes, audio_scales):
frames = self._decode_frame(frame, scale)
decoded_frames.append(frames)
audio_values = self._linear_overlap_add(
decoded_frames, self.chunk_stride or 1
)
# truncate based on padding mask
if padding_mask is not None and padding_mask.shape[1] < audio_values.shape[1]:
audio_values = audio_values[:, : padding_mask.shape[1]]
return audio_values
@classmethod
def from_pretrained(cls, path_or_repo: str):
from huggingface_hub import snapshot_download
path = Path(path_or_repo)
if not path.exists():
path = Path(
snapshot_download(
repo_id=path_or_repo,
allow_patterns=["*.json", "*.safetensors", "*.model"],
)
)
with open(path / "config.json", "r") as f:
config = SimpleNamespace(**json.load(f))
model = EncodecModel(config)
model.load_weights(str(path / "model.safetensors"))
processor = functools.partial(
preprocess_audio,
sampling_rate=config.sampling_rate,
chunk_length=model.chunk_length,
chunk_stride=model.chunk_stride,
)
mx.eval(model)
return model, processor
def preprocess_audio(
raw_audio: Union[mx.array, List[mx.array]],
sampling_rate: int = 24000,
chunk_length: Optional[int] = None,
chunk_stride: Optional[int] = None,
):
r"""
Prepare inputs for the EnCodec model.
Args:
raw_audio (mx.array or List[mx.array]): The sequence or batch of
sequences to be processed.
sampling_rate (int): The sampling rate at which the audio waveform
should be digitalized.
chunk_length (int, optional): The model's chunk length.
chunk_stride (int, optional): The model's chunk stride.
"""
if not isinstance(raw_audio, list):
raw_audio = [raw_audio]
raw_audio = [x[..., None] if x.ndim == 1 else x for x in raw_audio]
max_length = max(array.shape[0] for array in raw_audio)
if chunk_length is not None:
max_length += chunk_length - (max_length % chunk_stride)
inputs = []
masks = []
for x in raw_audio:
length = x.shape[0]
mask = mx.ones((length,), dtype=mx.bool_)
difference = max_length - length
if difference > 0:
mask = mx.pad(mask, (0, difference))
x = mx.pad(x, ((0, difference), (0, 0)))
inputs.append(x)
masks.append(mask)
return mx.stack(inputs), mx.stack(masks)

View File

@@ -1,39 +0,0 @@
# Copyright © 2024 Apple Inc.
import mlx.core as mx
from utils import load_audio, save_audio
from encodec import EncodecModel
# Load the 48 KHz model and preprocessor.
model, processor = EncodecModel.from_pretrained("mlx-community/encodec-48khz-float32")
# Load an audio file
audio = load_audio("/path/to/audio", model.sampling_rate, model.channels)
# Preprocess the audio (this can also be a list of arrays for batched
# processing).
feats, mask = processor(audio)
# Encode at the given bandwidth. A lower bandwidth results in more
# compression but lower reconstruction quality.
@mx.compile
def encode(feats, mask):
return model.encode(feats, mask, bandwidth=3)
# Decode to reconstruct the audio
@mx.compile
def decode(codes, scales, mask):
return model.decode(codes, scales, mask)
codes, scales = encode(feats, mask)
reconstructed = decode(codes, scales, mask)
# Trim any padding:
reconstructed = reconstructed[0, : len(audio)]
# Save the audio as a wave file
save_audio("reconstructed.wav", reconstructed, model.sampling_rate)

View File

@@ -1,3 +0,0 @@
mlx>=0.18
numpy
huggingface_hub

View File

@@ -1,67 +0,0 @@
# Copyright © 2024 Apple Inc.
import mlx.core as mx
import numpy as np
import torch
from transformers import AutoProcessor
from transformers import EncodecModel as PTEncodecModel
from encodec import EncodecModel, preprocess_audio
def compare_processors():
np.random.seed(0)
audio_length = 95500
audio = np.random.uniform(size=(2, audio_length)).astype(np.float32)
processor = AutoProcessor.from_pretrained("facebook/encodec_48khz")
pt_inputs = processor(
raw_audio=audio, sampling_rate=processor.sampling_rate, return_tensors="pt"
)
mx_inputs = preprocess_audio(
mx.array(audio).T,
processor.sampling_rate,
processor.chunk_length,
processor.chunk_stride,
)
assert np.array_equal(pt_inputs["input_values"], mx_inputs[0].moveaxis(2, 1))
assert np.array_equal(pt_inputs["padding_mask"], mx_inputs[1])
def compare_models():
pt_model = PTEncodecModel.from_pretrained("facebook/encodec_48khz")
mx_model, _ = EncodecModel.from_pretrained("mlx-community/encodec-48khz-float32")
np.random.seed(0)
audio_length = 190560
audio = np.random.uniform(size=(1, audio_length, 2)).astype(np.float32)
mask = np.ones((1, audio_length), dtype=np.int32)
pt_encoded = pt_model.encode(
torch.tensor(audio).moveaxis(2, 1), torch.tensor(mask)[None]
)
mx_encoded = mx_model.encode(mx.array(audio), mx.array(mask))
pt_codes = pt_encoded.audio_codes.numpy()
mx_codes = mx_encoded[0]
assert np.array_equal(pt_codes, mx_codes), "Encoding codes mismatch"
for mx_scale, pt_scale in zip(mx_encoded[1], pt_encoded.audio_scales):
if mx_scale is not None:
pt_scale = pt_scale.numpy()
assert np.allclose(pt_scale, mx_scale, atol=1e-3, rtol=1e-4)
pt_audio = pt_model.decode(
pt_encoded.audio_codes, pt_encoded.audio_scales, torch.tensor(mask)[None]
)
pt_audio = pt_audio[0].squeeze().T.detach().numpy()
mx_audio = mx_model.decode(*mx_encoded, mx.array(mask))
mx_audio = mx_audio.squeeze()
assert np.allclose(
pt_audio, mx_audio, atol=1e-4, rtol=1e-4
), "Decoding audio mismatch"
if __name__ == "__main__":
compare_processors()
compare_models()

View File

@@ -1,52 +0,0 @@
# Copyright © 2024 Apple Inc.
import mlx.core as mx
import numpy as np
def save_audio(file: str, audio: mx.array, sampling_rate: int):
"""
Save audio to a wave (.wav) file.
"""
from scipy.io.wavfile import write
audio = (audio * 32767).astype(mx.int16)
write(file, sampling_rate, np.array(audio))
def load_audio(file: str, sampling_rate: int, channels: int):
"""
Read audio into an mx.array, resampling if necessary.
Args:
file (str): The audio file to open.
sampling_rate (int): The sample rate to resample the audio at if needed.
channels (int): The number of audio channels.
Returns:
An mx.array containing the audio waveform in float32.
"""
from subprocess import CalledProcessError, run
# This launches a subprocess to decode audio while down-mixing
# and resampling as necessary. Requires the ffmpeg CLI in PATH.
# fmt: off
cmd = [
"ffmpeg",
"-nostdin",
"-threads", "0",
"-i", file,
"-f", "s16le",
"-ac", str(channels),
"-acodec", "pcm_s16le",
"-ar", str(sampling_rate),
"-"
]
# fmt: on
try:
out = run(cmd, capture_output=True, check=True).stdout
except CalledProcessError as e:
raise RuntimeError(f"Failed to load audio: {e.stderr.decode()}") from e
out = mx.array(np.frombuffer(out, np.int16))
return out.reshape(-1, channels).astype(mx.float32) / 32767.0

View File

@@ -1,156 +0,0 @@
# ESM-2
This repository provides an implementation of Meta's ESM-2 protein language model
in MLX.[^1] ESM-2 is Metas second-generation Evolutionary Scale Model, a
transformer-based protein language model trained on millions of diverse protein
sequences with a masked language modeling objective.
![Example contact prediction map](assets/contact_prediction.png)
_Example contact prediction map for a universal stress protein. In this case, ESM-2 650M achieves 86.4% precision at long-range contacts._
## Setup
Install the requirements:
```bash
pip install -r requirements.txt
```
## Usage
Below are the available ESM-2 models:
| Model | Parameters | Layers |
|-------|------------|--------|
| [`esm2_t6_8M_UR50D`](https://huggingface.co/facebook/esm2_t6_8M_UR50D) | 8M | 6 |
| [`esm2_t12_35M_UR50D`](https://huggingface.co/facebook/esm2_t12_35M_UR50D) | 35M | 12 |
| [`esm2_t30_150M_UR50D`](https://huggingface.co/facebook/esm2_t30_150M_UR50D) | 150M | 30 |
| [`esm2_t33_650M_UR50D`](https://huggingface.co/facebook/esm2_t33_650M_UR50D) | 650M | 33 |
| [`esm2_t36_3B_UR50D`](https://huggingface.co/facebook/esm2_t36_3B_UR50D) | 3B | 36 |
| [`esm2_t48_15B_UR50D`](https://huggingface.co/facebook/esm2_t48_15B_UR50D) | 15B | 48 |
Convert a model to MLX format:
```bash
python convert.py --hf-path facebook/esm2_t33_650M_UR50D
```
This will save the converted model in a checkpoints directory.
### Basic Inference
```python
from esm import ESM2
# Load model and tokenizer
tokenizer, model = ESM2.from_pretrained("checkpoints/mlx-esm2_t33_650M_UR50D")
# Example protein sequence (human insulin)
sequence = "MALWMRLLPLLALLALWGPDPAAAFVNQHLCGSHLVEALYLVCGERGFFYTPKTRREAEDLQVGQVELGGGPGAGSLQPLALEGSLQKRGIVEQCCTSICSLYQLENYCN"
# Tokenize and run inference
tokens = tokenizer.encode(sequence)
result = model(tokens)
logits = result["logits"] # Shape: (batch, length, vocab_size)
```
### Masked Language Modeling
```bash
# For a complete example, see main.py
python main.py --sequence "YOUR_SEQUENCE" --mask-position 50
```
### Embeddings
```python
# Get sequence-level representations
seq_repr = model.get_sequence_representations(tokens, layer=-1) # Shape: (batch, embed_dim)
# Extract per-residue representations from specific layers
representations = model.extract_features(tokens, repr_layers=[20, 30, 33])
final_layer = representations[33] # Shape: (batch, length, embed_dim)
```
### Contact Prediction
```python
# Predict residue-residue contacts
contacts = model.predict_contacts(tokens) # Shape: (batch, length, length)
# Or compute contacts together with logits, representations, etc.
outputs = model(tokens, return_contacts=True)
contacts = outputs["contacts"]
```
### Examples
**Mutation Effect Prediction**: [notebooks/mutation_effect_prediction.ipynb](notebooks/mutation_effect_prediction.ipynb)
This notebook demonstrates how to use ESM-2 for zero-shot mutation effect prediction by scoring amino acid substitutions based on their likelihood under the model. We validate the approach using experimental fitness data from β-lactamase TEM, showing how ESM-2 captures functional constraints without requiring structural information.
**Embeddings**: [notebooks/embeddings.ipynb](notebooks/embeddings.ipynb)
This notebook explores how ESM-2 generates meaningful protein embeddings that capture evolutionary and functional relationships between proteins. We analyze six diverse human proteins to demonstrate how the learned representations cluster proteins by function and reveal biological similarities.
**Contact Prediction**: [notebooks/contact_prediction.ipynb](notebooks/contact_prediction.ipynb)
This notebook shows how to predict residue-residue contacts in protein structures using ESM-2's attention patterns. We evaluate contact prediction performance on three diverse proteins, demonstrating how the model captures both local and long-range structural relationships directly from sequence data.
### Benchmarking
Benchmark MLX performance:
```bash
python benchmarks/benchmark_mx.py
```
Benchmark PyTorch MPS performance:
```bash
python benchmarks/benchmark_pt.py
```
Expected performance on M4 MacBook Pro (ESM-2 650M, batch_size = 5):
- MLX: 299 ms per step, 16.71 sequences/sec
- PyTorch MPS: 402 ms per step, 12.43 sequences/sec
### Testing
Verify correctness against original implementation:
```bash
python test.py
```
This tests tokenizer and model outputs (logits, hidden states, and attentions) for equivalence with the original implementation.
### Citations:
```bibtex
@article{rives2019biological,
author={Rives, Alexander and Meier, Joshua and Sercu, Tom and Goyal, Siddharth and Lin, Zeming and Liu, Jason and Guo, Demi and Ott, Myle and Zitnick, C. Lawrence and Ma, Jerry and Fergus, Rob},
title={Biological Structure and Function Emerge from Scaling Unsupervised Learning to 250 Million Protein Sequences},
year={2019},
doi={10.1101/622803},
url={https://www.biorxiv.org/content/10.1101/622803v4},
journal={PNAS}
}
```
```bibtex
@article{Lin2023,
author={Zeming Lin et al.},
title={Evolutionary-scale prediction of atomic-level protein structure with a language model},
journal={Science},
volume={379},
pages={1123--1130},
year={2023},
doi={10.1126/science.ade2574},
url={https://doi.org/10.1126/science.ade2574}
}
```
[^1]: Refer to the [paper](https://www.science.org/doi/10.1126/science.ade2574) and [code](https://github.com/facebookresearch/esm) for more details.

Binary file not shown.

Before

Width:  |  Height:  |  Size: 34 KiB

View File

@@ -1,47 +0,0 @@
import sys
import time
from pathlib import Path
import mlx.core as mx
# Add parent directory to Python path
cur_path = Path(__file__).parents[1].resolve()
sys.path.append(str(cur_path))
from esm import ESM2
# Example protein sequence (Green Fluorescent Protein)
protein_sequence = "MSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVTTFSYGVQCFSRYPDHMKQHDFFKSAMPEGYVQERTIFFKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYNSHNVYIMADKQKNGIKVNFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSTQSALSKDPNEKRDHMVLLEFVTAAGITHGMDELYK"
# Load pretrained ESM-2 model and its tokenizer from local checkpoint
tokenizer, model = ESM2.from_pretrained("checkpoints/mlx-esm2_t33_650M_UR50D")
# Number of sequences to process in each forward pass
batch_size = 5
# Number of timing iterations for performance measurement
steps = 50
# Tokenize the protein sequence into integer IDs for the model
# Replicate the same sequence 'batch_size' times to create a batch
tokens = tokenizer.batch_encode([protein_sequence] * batch_size)
# Warm-up phase
for _ in range(10):
result = model(tokens)
mx.eval(result["logits"]) # Force computation to complete
# Measure average inference time over 'steps' iterations
tic = time.time()
for _ in range(steps):
result = model(tokens)
mx.eval(result["logits"]) # Synchronize and ensure computation finishes
toc = time.time()
# Compute metrics: average time per step (ms) and throughput (sequences/sec)
ms_per_step = 1000 * (toc - tic) / steps
throughput = batch_size * 1000 / ms_per_step
# Display results
print(f"Time (ms) per step: {ms_per_step:.3f}")
print(f"Throughput: {throughput:.2f} sequences/sec")

View File

@@ -1,52 +0,0 @@
import time
import torch
from transformers import AutoTokenizer, EsmForMaskedLM
# Example protein sequence (Green Fluorescent Protein)
protein_sequence = "MSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVTTFSYGVQCFSRYPDHMKQHDFFKSAMPEGYVQERTIFFKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYNSHNVYIMADKQKNGIKVNFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSTQSALSKDPNEKRDHMVLLEFVTAAGITHGMDELYK"
# Hugging Face model identifier for ESM-2 (33 layers, 650M params, UR50D training set)
model_name = "facebook/esm2_t33_650M_UR50D"
# Load tokenizer and model; move model to Apple Metal Performance Shaders (MPS) device
tokenizer = AutoTokenizer.from_pretrained(model_name)
model = EsmForMaskedLM.from_pretrained(model_name).to("mps")
# Number of sequences per forward pass
batch_size = 5
# Number of timing iterations
steps = 50
# Tokenize input sequence and replicate for the batch
# Replicate the same sequence 'batch_size' times to create a batch
inputs = tokenizer(
[protein_sequence] * batch_size,
return_tensors="pt",
padding=True,
truncation=True,
max_length=1024,
)
input_ids = inputs["input_ids"].to("mps")
attention_mask = inputs["attention_mask"].to("mps")
# Warm-up phase
for _ in range(10):
outputs = model(input_ids=input_ids, attention_mask=attention_mask)
torch.mps.synchronize() # Ensure all queued ops on MPS are complete before next step
# Timed inference loop
tic = time.time()
for _ in range(steps):
outputs = model(input_ids=input_ids, attention_mask=attention_mask)
torch.mps.synchronize() # Wait for computation to finish before timing next iteration
toc = time.time()
# Compute performance metrics
ms_per_step = 1000 * (toc - tic) / steps
throughput = batch_size * 1000 / ms_per_step
# Report results
print(f"Time (ms) per step: {ms_per_step:.3f}")
print(f"Throughput: {throughput:.2f} sequences/sec")

View File

@@ -1,177 +0,0 @@
import argparse
import json
import shutil
from pathlib import Path
from typing import Dict
import mlx.core as mx
import torch
from huggingface_hub import snapshot_download
def download(hf_repo: str) -> Path:
"""Download model from Hugging Face."""
return Path(
snapshot_download(
repo_id=hf_repo,
allow_patterns=["*.safetensors", "*.json", "*.bin", "*.txt"],
)
)
def remap_key(key: str) -> str:
"""Remap HuggingFace ESM key names to MLX format."""
# Skip position embeddings and position_ids
if "position_embeddings" in key or "position_ids" in key:
return None
# Map lm_head components properly
if key == "lm_head.decoder.weight":
return "lm_head.weight"
if key == "lm_head.decoder.bias":
return "lm_head.bias"
if key == "lm_head.dense.weight":
return "lm_head.dense.weight"
if key == "lm_head.dense.bias":
return "lm_head.dense.bias"
if key == "lm_head.layer_norm.weight":
return "lm_head.layer_norm.weight"
if key == "lm_head.layer_norm.bias":
return "lm_head.layer_norm.bias"
# Core remapping patterns
key = key.replace("esm.embeddings.word_embeddings", "embed_tokens")
key = key.replace("esm.encoder.emb_layer_norm_after", "emb_layer_norm_after")
key = key.replace("esm.encoder.layer.", "layer_")
key = key.replace("esm.contact_head", "contact_head")
key = key.replace("lm_head", "lm_head")
# Attention patterns
key = key.replace(".attention.self.", ".self_attn.")
key = key.replace(".attention.output.dense", ".self_attn.out_proj")
key = key.replace(".attention.LayerNorm", ".self_attn_layer_norm")
key = key.replace(".query", ".q_proj")
key = key.replace(".key", ".k_proj")
key = key.replace(".value", ".v_proj")
key = key.replace(".rotary_embeddings", ".rot_emb")
# FFN patterns
key = key.replace(".intermediate.dense", ".fc1")
key = key.replace(".output.dense", ".fc2")
key = key.replace(".LayerNorm", ".final_layer_norm")
return key
def load_weights(model_path: Path) -> Dict:
"""Load weights from safetensors or PyTorch bin files."""
# Check for safetensors file
safetensors_path = model_path / "model.safetensors"
if safetensors_path.exists():
print("Loading from safetensors...")
return mx.load(str(safetensors_path))
# Check for single bin file
single_bin_path = model_path / "pytorch_model.bin"
if single_bin_path.exists():
print("Loading from pytorch_model.bin...")
state_dict = torch.load(str(single_bin_path), map_location="cpu")
return {k: v.numpy() for k, v in state_dict.items()}
# Check for sharded bin files
index_file = model_path / "pytorch_model.bin.index.json"
if index_file.exists():
print("Loading from sharded bin files...")
with open(index_file) as f:
index = json.load(f)
# Get unique shard files
shard_files = set(index["weight_map"].values())
# Load all shards
state_dict = {}
for shard_file in sorted(shard_files):
print(f" Loading shard: {shard_file}")
shard_path = model_path / shard_file
shard_dict = torch.load(str(shard_path), map_location="cpu")
state_dict.update(shard_dict)
return {k: v.numpy() for k, v in state_dict.items()}
raise ValueError(f"No model weights found in {model_path}")
def convert(model_path: Path) -> Dict[str, mx.array]:
"""Convert ESM weights to MLX format."""
# Load weights from any format
weights = load_weights(model_path)
# Convert keys and create MLX arrays
mlx_weights = {}
for key, value in weights.items():
mlx_key = remap_key(key)
if mlx_key is not None:
mlx_weights[mlx_key] = (
mx.array(value) if not isinstance(value, mx.array) else value
)
# If lm_head.weight is missing but embed_tokens.weight exists, set up weight sharing
# (This is for smaller models that don't have a separate lm_head.decoder.weight)
if "lm_head.weight" not in mlx_weights and "embed_tokens.weight" in mlx_weights:
mlx_weights["lm_head.weight"] = mlx_weights["embed_tokens.weight"]
return mlx_weights
def main():
parser = argparse.ArgumentParser(description="Convert ESM weights to MLX format")
parser.add_argument(
"--hf-path", default="facebook/esm2_t6_8M_UR50D", help="Hugging Face model path"
)
parser.add_argument("--mlx-path", default=None, help="Output path for MLX model")
parser.add_argument(
"--checkpoints-dir",
default="checkpoints",
help="Directory to save checkpoints (default: checkpoints)",
)
args = parser.parse_args()
# Download model
print(f"Downloading {args.hf_path}...")
model_path = download(args.hf_path)
# Set output path
if args.mlx_path is None:
model_name = args.hf_path.split("/")[-1]
checkpoints_dir = Path(args.checkpoints_dir)
checkpoints_dir.mkdir(parents=True, exist_ok=True)
args.mlx_path = checkpoints_dir / f"mlx-{model_name}"
mlx_path = Path(args.mlx_path)
mlx_path.mkdir(parents=True, exist_ok=True)
# Convert weights
print("Converting weights...")
mlx_weights = convert(model_path)
# Save weights
print(f"Saving MLX weights to {mlx_path}...")
mx.save_safetensors(str(mlx_path / "model.safetensors"), mlx_weights)
# Copy config and other files
print("Copying config...")
shutil.copy(model_path / "config.json", mlx_path / "config.json")
for file_name in ["special_tokens_map.json", "tokenizer.json", "vocab.txt"]:
src_file = model_path / file_name
if src_file.exists():
shutil.copy(src_file, mlx_path / file_name)
print(f"Conversion complete! MLX model saved to {mlx_path}")
if __name__ == "__main__":
main()

View File

@@ -1,19 +0,0 @@
"""
ESM-2 protein language model implementation in MLX
"""
from .attention import MultiheadAttention
from .model import ESM2
from .modules import ContactPredictionHead, RobertaLMHead, TransformerLayer
from .rotary_embedding import RotaryEmbedding
from .tokenizer import ProteinTokenizer
__all__ = [
"ESM2",
"ProteinTokenizer",
"ContactPredictionHead",
"RobertaLMHead",
"TransformerLayer",
"MultiheadAttention",
"RotaryEmbedding",
]

View File

@@ -1,153 +0,0 @@
from typing import Optional, Tuple
import mlx.core as mx
import mlx.nn as nn
from .rotary_embedding import RotaryEmbedding
class MultiheadAttention(nn.Module):
"""
Multi-head attention layer with rotary position embeddings, as used in ESM-2.
This module implements both self-attention (when `key` and `value` are not
provided) and cross-attention. It projects input sequences into queries,
keys, and values, applies rotary position embeddings to encode relative
position information, computes scaled dot-product attention over multiple
heads in parallel, and returns a combined output projection.
Args:
embed_dim (int): Total embedding dimension of the model input and output.
num_heads (int): Number of parallel attention heads. Must divide `embed_dim`.
"""
def __init__(
self,
embed_dim,
num_heads,
):
super().__init__()
self.embed_dim = embed_dim
self.num_heads = num_heads
self.head_dim = embed_dim // num_heads
assert (
self.head_dim * num_heads == self.embed_dim
), "embed_dim must be divisible by num_heads"
self.scaling = self.head_dim**-0.5
# Linear projections for queries, keys, and values (with bias)
self.q_proj = nn.Linear(embed_dim, embed_dim, bias=True)
self.k_proj = nn.Linear(embed_dim, embed_dim, bias=True)
self.v_proj = nn.Linear(embed_dim, embed_dim, bias=True)
# Linear projection for output (with bias)
self.out_proj = nn.Linear(embed_dim, embed_dim, bias=True)
# ESM-2 uses rotary embeddings
self.rot_emb = RotaryEmbedding(dim=self.head_dim)
def __call__(
self,
query,
key: Optional[mx.array] = None,
value: Optional[mx.array] = None,
key_padding_mask: Optional[mx.array] = None,
attn_mask: Optional[mx.array] = None,
need_head_weights: bool = False,
) -> Tuple[mx.array, Optional[mx.array]]:
"""
Multi-head attention forward pass.
Args:
query: Tensor of shape (tgt_len, batch, embed_dim).
key: Optional tensor of shape (src_len, batch, embed_dim). Defaults to `query`.
value: Optional tensor of shape (src_len, batch, embed_dim). Defaults to `query`.
key_padding_mask: Optional mask of shape (batch, src_len) to ignore padded positions.
attn_mask: Optional mask for attention (e.g., causal mask).
need_head_weights: If True, return attention weights for each head separately.
Returns:
attn_output: Tensor of shape (tgt_len, batch, embed_dim).
attn_weights_out: Attention weights of shape
(num_heads, batch, tgt_len, src_len) if per-head,
or (batch, tgt_len, src_len) if averaged.
"""
tgt_len, bsz, embed_dim = query.shape
assert embed_dim == self.embed_dim
# For self-attention, use query as key and value if not provided
if key is None:
key = query
if value is None:
value = query
# Project queries, keys, values
q = self.q_proj(query)
k = self.k_proj(key)
v = self.v_proj(value)
q = q * self.scaling
# Reshape for multi-head attention
q = q.reshape(tgt_len, bsz * self.num_heads, self.head_dim).swapaxes(0, 1)
k = k.reshape(-1, bsz * self.num_heads, self.head_dim).swapaxes(0, 1)
v = v.reshape(-1, bsz * self.num_heads, self.head_dim).swapaxes(0, 1)
src_len = k.shape[1]
# Apply rotary embeddings if present
if self.rot_emb:
q, k = self.rot_emb(q, k)
# Compute attention weights
attn_weights = q @ k.swapaxes(-2, -1)
assert list(attn_weights.shape) == [bsz * self.num_heads, tgt_len, src_len]
# Apply attention mask
if attn_mask is not None:
attn_mask = mx.expand_dims(attn_mask, 0)
attn_weights = attn_weights + attn_mask
# Apply key padding mask
if key_padding_mask is not None:
attn_weights = attn_weights.reshape(bsz, self.num_heads, tgt_len, src_len)
# Convert key_padding_mask to boolean and expand dimensions
# key_padding_mask: [bsz, src_len] -> [bsz, 1, 1, src_len]
mask = mx.expand_dims(
mx.expand_dims(key_padding_mask.astype(mx.bool_), 1), 2
)
# Apply mask: set attention to -inf where mask is True (padded positions)
attn_weights = mx.where(mask, -mx.inf, attn_weights)
attn_weights = attn_weights.reshape(bsz * self.num_heads, tgt_len, src_len)
# Apply softmax
attn_weights_float = mx.softmax(attn_weights.astype(mx.float32), axis=-1)
attn_probs = attn_weights_float
# Compute attention output
attn = attn_probs @ v
assert list(attn.shape) == [bsz * self.num_heads, tgt_len, self.head_dim]
# Reshape output
attn = attn.swapaxes(0, 1).reshape(tgt_len, bsz, embed_dim)
attn = self.out_proj(attn)
# Return attention weights if requested
attn_weights_out: Optional[mx.array] = None
if need_head_weights:
# Return attention weights for each head separately
attn_weights_out = (
attn_weights_float.reshape(bsz, self.num_heads, tgt_len, src_len)
.astype(attn.dtype)
.swapaxes(0, 1)
)
else:
# Return averaged attention weights
attn_weights_out = mx.mean(
attn_weights_float.reshape(bsz, self.num_heads, tgt_len, src_len),
axis=1,
).astype(attn.dtype)
return attn, attn_weights_out

View File

@@ -1,343 +0,0 @@
import json
from pathlib import Path
from typing import Dict, List, Optional, Tuple
import mlx.core as mx
import mlx.nn as nn
from .modules import ContactPredictionHead, RobertaLMHead, TransformerLayer
from .tokenizer import ProteinTokenizer
class ESM2(nn.Module):
"""
ESM-2 protein language model in MLX.
Args:
num_layers (int): Number of transformer layers.
embed_dim (int): Embedding dimension.
attention_heads (int): Number of attention heads.
tokenizer (Optional[ProteinTokenizer]): Tokenizer to use (created if None).
token_dropout (bool): Apply token-dropout masking behavior.
"""
def __init__(
self,
num_layers: int = 33,
embed_dim: int = 1280,
attention_heads: int = 20,
tokenizer: Optional[ProteinTokenizer] = None,
token_dropout: bool = True,
):
super().__init__()
self.num_layers = num_layers
self.embed_dim = embed_dim
self.attention_heads = attention_heads
# Initialize tokenizer
if tokenizer is None:
tokenizer = ProteinTokenizer()
self.tokenizer = tokenizer
self.vocab_size = len(tokenizer)
# Special token IDs / config
self.padding_idx = tokenizer.pad_id
self.mask_idx = tokenizer.mask_id
self.cls_idx = tokenizer.cls_id
self.eos_idx = tokenizer.eos_id
self.prepend_bos = tokenizer.prepend_bos
self.append_eos = tokenizer.append_eos
self.token_dropout = token_dropout
self._init_submodules()
def _init_submodules(self) -> None:
"""Initialize embeddings, transformer stack, and output heads."""
self.embed_scale = 1
# Token embeddings
self.embed_tokens = nn.Embedding(self.vocab_size, self.embed_dim)
# Transformer layers (register each layer so MLX tracks parameters)
self._layer_indices = list(range(self.num_layers))
for i in self._layer_indices:
layer = TransformerLayer(
self.embed_dim,
4 * self.embed_dim, # FFN dimension = 4×embed_dim
self.attention_heads,
)
setattr(self, f"layer_{i}", layer)
# Contact prediction head (uses all layers × heads attentions)
self.contact_head = ContactPredictionHead(
self.num_layers * self.attention_heads,
self.prepend_bos,
self.append_eos,
eos_idx=self.eos_idx,
)
# Final norm + LM head (tied weights)
self.emb_layer_norm_after = nn.LayerNorm(self.embed_dim)
self.lm_head = RobertaLMHead(
embed_dim=self.embed_dim,
output_dim=self.vocab_size,
weight=self.embed_tokens.weight,
)
def __call__(
self,
tokens: mx.array,
repr_layers: List[int] = [],
need_head_weights: bool = False,
return_contacts: bool = False,
) -> Dict[str, mx.array]:
"""
Forward pass through ESM-2.
Args:
tokens: Tensor of token IDs with shape (B, T).
repr_layers: Layers to return hidden states from (0..num_layers).
need_head_weights: If True, return attention weights.
return_contacts: If True, compute residue-residue contact probabilities.
Returns:
dict with:
logits: (B, T, V)
representations: {layer_idx: (B, T, E)}
attentions: (B, L, H, T, T) if requested
contacts: (B, T', T') if requested
"""
if return_contacts:
need_head_weights = True
# Ensure tokens is 2D (B, T)
if tokens.ndim == 1:
tokens = mx.expand_dims(tokens, axis=0)
assert tokens.ndim == 2
# Padding mask (B, T)
padding_mask = mx.equal(tokens, self.padding_idx)
# Embed tokens (B, T, E)
x = self.embed_scale * self.embed_tokens(tokens)
# Token dropout: zero masked tokens + rescale based on observed mask ratio
if self.token_dropout:
mask_positions = mx.equal(tokens, self.mask_idx)
x = mx.where(mask_positions[:, :, None], mx.zeros_like(x), x)
mask_ratio_train = 0.15 * 0.8
src_lengths = mx.sum(~padding_mask, axis=-1, keepdims=True)
mask_ratio_observed = (
mx.sum(mask_positions, axis=-1, keepdims=True) / src_lengths
)
scale_factor = (1 - mask_ratio_train) / mx.maximum(
1 - mask_ratio_observed, 1e-8
)
x = x * scale_factor[:, None, :]
# Zero out padding positions
if padding_mask.any():
x = x * (1 - padding_mask[:, :, None].astype(x.dtype))
# Track requested representations
repr_layers = set(repr_layers)
hidden_representations: Dict[int, mx.array] = {}
if 0 in repr_layers:
hidden_representations[0] = x
if need_head_weights:
attn_weights: List[mx.array] = []
# (B, T, E) -> (T, B, E) for transformer layers
x = mx.swapaxes(x, 0, 1)
# If no padding anywhere, skip the mask
if not padding_mask.any():
padding_mask = None
# Transformer stack
for layer_idx in self._layer_indices:
layer = getattr(self, f"layer_{layer_idx}")
x, attn = layer(
x,
self_attn_padding_mask=padding_mask,
need_head_weights=need_head_weights,
)
# Save hidden representation if requested (store back as (B, T, E))
if (layer_idx + 1) in repr_layers:
hidden_representations[layer_idx + 1] = mx.swapaxes(x, 0, 1)
# Save per-layer attentions if requested (H, B, T, T) -> (B, H, T, T)
if need_head_weights:
attn_weights.append(mx.swapaxes(attn, 0, 1))
# Final layer norm, back to (B, T, E)
x = self.emb_layer_norm_after(x)
x = mx.swapaxes(x, 0, 1)
# Save final hidden if requested
if (layer_idx + 1) in repr_layers:
hidden_representations[layer_idx + 1] = x
# Language modeling logits
x = self.lm_head(x)
# Build result dict
result: Dict[str, mx.array] = {
"logits": x,
"representations": hidden_representations,
}
# Collect attentions and optional contacts
if need_head_weights:
# Stack layers -> (B, L, H, T, T)
attentions = mx.stack(attn_weights, axis=1)
# Mask out padded positions if present
if padding_mask is not None:
attention_mask = 1 - padding_mask.astype(attentions.dtype)
attention_mask = mx.expand_dims(attention_mask, 1) * mx.expand_dims(
attention_mask, 2
)
attentions = attentions * attention_mask[:, None, None, :, :]
result["attentions"] = attentions
# Compute contacts if requested
if return_contacts:
contacts = self.contact_head(tokens, attentions)
result["contacts"] = contacts
return result
def predict_contacts(self, tokens: mx.array) -> mx.array:
"""
Predict residue-residue contacts.
Args:
tokens: Tensor of shape (B, T).
Returns:
mx.array: Contact probabilities of shape (B, T', T').
"""
return self(tokens, return_contacts=True)["contacts"]
def extract_features(
self,
tokens: mx.array,
repr_layers: Optional[List[int]] = None,
return_all_hiddens: bool = False,
) -> Dict[int, mx.array]:
"""
Extract hidden representations from selected layers.
Args:
tokens: Tensor of shape (B, T).
repr_layers: Layer indices to return (default: last layer).
return_all_hiddens: If True, return all layers (0..num_layers).
Returns:
dict: {layer_idx: (B, T, E)} for requested layers.
"""
if return_all_hiddens:
repr_layers = list(range(self.num_layers + 1))
elif repr_layers is None:
repr_layers = [self.num_layers]
result = self(tokens, repr_layers=repr_layers)
return result["representations"]
def get_sequence_representations(
self,
tokens: mx.array,
layer: int = -1,
) -> mx.array:
"""
Average token representations into a per-sequence embedding.
Args:
tokens: Tensor of shape (B, T).
layer: Layer index to use (-1 or num_layers for last).
Returns:
mx.array: Sequence embeddings of shape (B, E).
"""
if layer == -1:
layer = self.num_layers
representations = self.extract_features(tokens, repr_layers=[layer])
repr = representations[layer]
# Mask: non-padding and not CLS; optionally not EOS
mask = mx.logical_and(
mx.not_equal(tokens, self.padding_idx),
mx.not_equal(tokens, self.cls_idx),
)
if self.append_eos:
mask = mx.logical_and(mask, mx.not_equal(tokens, self.eos_idx))
# Mean over valid positions
mask = mask[:, :, None].astype(repr.dtype)
masked_repr = repr * mask
seq_lens = mx.sum(mask, axis=1, keepdims=True)
seq_repr = mx.sum(masked_repr, axis=1) / mx.maximum(seq_lens[:, :, 0], 1.0)
return seq_repr
@classmethod
def from_pretrained(cls, model_path: str) -> Tuple[ProteinTokenizer, "ESM2"]:
"""
Load model weights and config from a directory.
Expects:
- config.json
- model.safetensors
- vocab.txt (optional, will use default if not found)
- special_tokens_map.json (optional, will use default if not found)
Args:
model_path: Path to directory with weights and config.
Returns:
(tokenizer, model): Initialized tokenizer and ESM2 model.
"""
model_dir = Path(model_path)
config_path = model_dir / "config.json"
with open(config_path, "r") as f:
config = json.load(f)
# Check for vocab and special tokens files
vocab_path = model_dir / "vocab.txt"
special_tokens_path = model_dir / "special_tokens_map.json"
if vocab_path.exists() and special_tokens_path.exists():
tokenizer = ProteinTokenizer(
vocab_file=str(vocab_path),
special_tokens_map_file=str(special_tokens_path),
)
else:
tokenizer = ProteinTokenizer()
model = cls(
num_layers=config["num_hidden_layers"],
embed_dim=config["hidden_size"],
attention_heads=config["num_attention_heads"],
tokenizer=tokenizer,
token_dropout=config["token_dropout"],
)
# Load safetensors as nested dict and update model params
weights_path = model_dir / "model.safetensors"
flat_weights = mx.load(str(weights_path))
nested_weights: Dict[str, dict] = {}
for key, value in flat_weights.items():
parts = key.split(".")
cur = nested_weights
for p in parts[:-1]:
cur = cur.setdefault(p, {})
cur[parts[-1]] = value
model.update(nested_weights)
return tokenizer, model

View File

@@ -1,212 +0,0 @@
from typing import Optional
import mlx.core as mx
import mlx.nn as nn
from .attention import MultiheadAttention
def symmetrize(x: mx.array) -> mx.array:
"""
Make a tensor symmetric over its last two dimensions.
Args:
x: Tensor with shape (..., L, L).
Returns:
mx.array: Symmetrized tensor of shape (..., L, L).
"""
# Add tensor to its transpose over the last two dims
return x + mx.swapaxes(x, -1, -2)
def apc(x: mx.array) -> mx.array:
"""
Apply Average Product Correction (APC) to remove background co-variation.
Args:
x: Tensor with shape (..., L, L).
Returns:
mx.array: APC-corrected tensor of shape (..., L, L).
"""
# Compute row, column, and total sums
a1 = mx.sum(x, axis=-1, keepdims=True)
a2 = mx.sum(x, axis=-2, keepdims=True)
a12 = mx.sum(x, axis=(-1, -2), keepdims=True)
# Expected co-variation under independence
expected = (a1 * a2) / a12
return x - expected
class TransformerLayer(nn.Module):
"""
Transformer layer used in ESM-2.
Args:
embed_dim (int): Model embedding dimension.
ffn_embed_dim (int): Hidden dimension of the feed-forward network.
attention_heads (int): Number of attention heads.
"""
def __init__(
self,
embed_dim: int,
ffn_embed_dim: int,
attention_heads: int,
):
super().__init__()
self.embed_dim = embed_dim
self.ffn_embed_dim = ffn_embed_dim
self.attention_heads = attention_heads
self._init_submodules()
def _init_submodules(self) -> None:
"""Initialize attention, norms, and feed-forward submodules."""
self.self_attn = MultiheadAttention(self.embed_dim, self.attention_heads)
self.self_attn_layer_norm = nn.LayerNorm(self.embed_dim)
self.fc1 = nn.Linear(self.embed_dim, self.ffn_embed_dim)
self.fc2 = nn.Linear(self.ffn_embed_dim, self.embed_dim)
self.final_layer_norm = nn.LayerNorm(self.embed_dim)
def __call__(
self,
x: mx.array,
self_attn_mask: Optional[mx.array] = None,
self_attn_padding_mask: Optional[mx.array] = None,
need_head_weights: bool = False,
):
"""
Forward pass for the Transformer layer.
Args:
x: Tensor of shape (seq_len, batch, embed_dim).
self_attn_mask: Optional attention mask.
self_attn_padding_mask: Optional padding mask of shape (batch, seq_len).
need_head_weights: If True, return per-head attention weights.
Returns:
x: Tensor of shape (seq_len, batch, embed_dim).
attn: Attention weights of shape
(num_heads, batch, tgt_len, src_len) if per-head,
or (batch, tgt_len, src_len) if averaged.
"""
# Self-attention block
residual = x
x = self.self_attn_layer_norm(x)
x, attn = self.self_attn(
query=x,
key_padding_mask=self_attn_padding_mask,
attn_mask=self_attn_mask,
need_head_weights=need_head_weights,
)
x = residual + x
# Feed-forward block
residual = x
x = self.final_layer_norm(x)
x = nn.gelu(self.fc1(x))
x = self.fc2(x)
x = residual + x
return x, attn
class RobertaLMHead(nn.Module):
"""
Masked Language Modeling (MLM) head with tied weights.
Args:
embed_dim (int): Embedding dimension of the backbone.
output_dim (int): Vocabulary size.
weight (mx.array): Embedding weight matrix for tied projection.
"""
def __init__(self, embed_dim: int, output_dim: int, weight: mx.array):
super().__init__()
self.dense = nn.Linear(embed_dim, embed_dim)
self.layer_norm = nn.LayerNorm(embed_dim)
self.weight = weight
self.bias = mx.zeros(output_dim)
def __call__(self, features: mx.array) -> mx.array:
"""
Forward pass for the MLM head.
Args:
features: Tensor of shape (seq_len, batch, embed_dim).
Returns:
mx.array: Logits of shape (seq_len, batch, output_dim).
"""
# Transform features before projection to vocab
x = self.dense(features)
x = nn.gelu(x)
x = self.layer_norm(x)
return mx.matmul(x, self.weight.T) + self.bias
class ContactPredictionHead(nn.Module):
"""
Predict residue-residue contact probabilities from attention maps.
Args:
in_features (int): Number of attention channels (layers × heads).
prepend_bos (bool): If True, drop BOS/CLS token attentions.
append_eos (bool): If True, drop EOS token attentions.
bias (bool): Whether the regression layer uses a bias term.
eos_idx (Optional[int]): Token ID for EOS; required if append_eos=True.
"""
def __init__(
self,
in_features: int,
prepend_bos: bool,
append_eos: bool,
bias: bool = True,
eos_idx: Optional[int] = None,
):
super().__init__()
self.in_features = in_features
self.prepend_bos = prepend_bos
self.append_eos = append_eos
if append_eos and eos_idx is None:
raise ValueError("append_eos=True but eos_idx was not provided.")
self.eos_idx = eos_idx
self.regression = nn.Linear(in_features, 1, bias=bias)
def __call__(self, tokens: mx.array, attentions: mx.array) -> mx.array:
"""
Forward pass for contact prediction.
Args:
tokens: Tensor of shape (B, T).
attentions: Tensor of shape (B, L, H, T, T).
Returns:
mx.array: Contact probabilities of shape (B, T', T'),
where T' = T - [prepend_bos] - [append_eos].
"""
# Remove EOS attentions if requested
if self.append_eos:
eos_mask = mx.not_equal(tokens, self.eos_idx).astype(attentions.dtype)
eos_mask = eos_mask[:, None, :] * eos_mask[:, :, None]
attentions = attentions * eos_mask[:, None, None, :, :]
attentions = attentions[..., :-1, :-1]
# Remove BOS attentions if requested
if self.prepend_bos:
attentions = attentions[..., 1:, 1:]
# Merge (layers × heads) into channel dimension
batch_size, layers, heads, seqlen, _ = attentions.shape
attentions = attentions.reshape(batch_size, layers * heads, seqlen, seqlen)
# Symmetrize and apply APC to enhance contact signal
attentions = apc(symmetrize(attentions))
# Apply logistic regression over channels
attentions = mx.transpose(attentions, axes=[0, 2, 3, 1])
logits = self.regression(attentions)
return nn.sigmoid(mx.squeeze(logits, axis=3))

View File

@@ -1,114 +0,0 @@
from typing import Tuple
import mlx.core as mx
import mlx.nn as nn
def rotate_half(x: mx.array) -> mx.array:
"""
Rotate last dimension by splitting into two halves and swapping.
Args:
x: Tensor with even-sized last dimension.
Returns:
mx.array: Tensor of same shape as `x` with halves rotated.
"""
# Split into two equal halves along the last dimension
x1, x2 = mx.split(x, 2, axis=-1)
# Swap halves and negate the second half
return mx.concatenate((-x2, x1), axis=-1)
def apply_rotary_pos_emb(x: mx.array, cos: mx.array, sin: mx.array) -> mx.array:
"""
Apply rotary position embeddings to a tensor.
Args:
x: Input tensor of shape (..., seq_len, dim).
cos: Cosine embedding table of shape (1, seq_len, dim).
sin: Sine embedding table of shape (1, seq_len, dim).
Returns:
mx.array: Tensor with rotary position embeddings applied.
"""
# Trim cos/sin to match the sequence length of x
cos = cos[:, : x.shape[-2], :]
sin = sin[:, : x.shape[-2], :]
# Elementwise rotation: (x * cos) + (rotate_half(x) * sin)
return (x * cos) + (rotate_half(x) * sin)
class RotaryEmbedding(nn.Module):
"""
Rotary position embedding (RoPE) module.
Args:
dim (int): Head dimension size (must be even).
"""
def __init__(self, dim: int, *_, **__):
super().__init__()
# Precompute inverse frequency for each pair of dimensions
self.inv_freq = 1.0 / (10000 ** (mx.arange(0, dim, 2).astype(mx.float32) / dim))
# Cache for cosine/sine tables to avoid recomputation
self._seq_len_cached = None
self._cos_cached = None
self._sin_cached = None
def _update_cos_sin_tables(
self, x: mx.array, seq_dimension: int = 1
) -> Tuple[mx.array, mx.array]:
"""
Compute and cache cos/sin tables for the given sequence length.
Args:
x: Reference tensor for sequence length.
seq_dimension: Axis containing the sequence length.
Returns:
Tuple of:
cos: Cosine table of shape (1, seq_len, dim).
sin: Sine table of shape (1, seq_len, dim).
"""
seq_len = x.shape[seq_dimension]
# Only update cache if sequence length has changed
if seq_len != self._seq_len_cached:
self._seq_len_cached = seq_len
# Time steps: shape (seq_len,)
t = mx.arange(seq_len).astype(self.inv_freq.dtype)
# Outer product between time and inverse frequency
freqs = mx.einsum("i,j->ij", t, self.inv_freq)
# Duplicate frequencies for cos/sin dimensions
emb = mx.concatenate((freqs, freqs), axis=-1)
self._cos_cached = mx.cos(emb)[None, :, :]
self._sin_cached = mx.sin(emb)[None, :, :]
return self._cos_cached, self._sin_cached
def __call__(self, q: mx.array, k: mx.array) -> Tuple[mx.array, mx.array]:
"""
Apply rotary position embeddings to queries and keys.
Args:
q: Query tensor of shape (..., seq_len, dim).
k: Key tensor of shape (..., seq_len, dim).
Returns:
Tuple of:
q_rot: Query tensor with RoPE applied.
k_rot: Key tensor with RoPE applied.
"""
# Get (and cache) cos/sin tables based on key sequence length
self._cos_cached, self._sin_cached = self._update_cos_sin_tables(
k, seq_dimension=-2
)
# Apply rotary embeddings to both q and k
return (
apply_rotary_pos_emb(q, self._cos_cached, self._sin_cached),
apply_rotary_pos_emb(k, self._cos_cached, self._sin_cached),
)

View File

@@ -1,241 +0,0 @@
import json
from pathlib import Path
from typing import List, Optional, Sequence, Union
import mlx.core as mx
# Canonical amino-acid tokens (IUPAC standard + uncommon variants)
PROTEIN_TOKENS = [
"L",
"A",
"G",
"V",
"S",
"E",
"R",
"T",
"I",
"D",
"P",
"K",
"Q",
"N",
"F",
"Y",
"M",
"H",
"W",
"C",
"X",
"B",
"U",
"Z",
"O",
".",
"-",
]
ArrayLike = Union[List[int], mx.array]
class ProteinTokenizer:
"""
Protein sequence tokenizer compatible with ESM-2.
This class converts protein sequences into token IDs and back, following
the vocabulary, special tokens, and formatting rules used by ESM-2.
"""
def __init__(
self,
vocab_file: Optional[str] = None,
special_tokens_map_file: Optional[str] = None,
):
"""
Initialize the ProteinTokenizer.
Args:
vocab_file: Optional path to a file containing the vocabulary,
one token per line.
special_tokens_map_file: Optional path to a JSON file defining
special token names and values.
If both files are provided, they override the default vocabulary and
special token mappings. Otherwise, defaults are loaded.
"""
# Load vocabulary from files if given, otherwise use built-in defaults
if vocab_file and special_tokens_map_file:
self._load_from_files(vocab_file, special_tokens_map_file)
else:
self._load_default_vocab()
# Create token ↔ ID mappings
self.token_to_id = {tok: i for i, tok in enumerate(self.vocab)}
self.id_to_token = {i: tok for i, tok in enumerate(self.vocab)}
# Cache special token IDs
self.cls_id = self.token_to_id["<cls>"]
self.pad_id = self.token_to_id["<pad>"]
self.eos_id = self.token_to_id["<eos>"]
self.unk_id = self.token_to_id["<unk>"]
self.mask_id = self.token_to_id["<mask>"]
# Behavior flags for ESM-2-style BOS/EOS
self.prepend_bos = True
self.append_eos = True
def _load_from_files(self, vocab_file: str, special_tokens_map_file: str) -> None:
"""Load vocabulary and special tokens from the provided files."""
# Vocabulary file: one token per line
vocab_path = Path(vocab_file)
with open(vocab_path, "r", encoding="utf-8") as f:
self.vocab = [line.strip() for line in f if line.strip()]
# Special tokens mapping file (JSON)
special_tokens_path = Path(special_tokens_map_file)
with open(special_tokens_path, "r", encoding="utf-8") as f:
self.special_tokens_map = json.load(f)
def _load_default_vocab(self) -> None:
"""Load the built-in ESM vocabulary and special token mapping."""
# ESM convention: prepend special tokens, then amino acids, then <mask>
prepend_toks = ["<cls>", "<pad>", "<eos>", "<unk>"]
append_toks = ["<mask>"]
self.vocab = prepend_toks + PROTEIN_TOKENS
# Pad vocab size to multiple of 8 (original implementation detail)
while len(self.vocab) % 8 != 0:
self.vocab.append(f"<null_{len(self.vocab) - len(prepend_toks)}>")
self.vocab.extend(append_toks)
# Default special tokens map
self.special_tokens_map = {
"cls_token": "<cls>",
"pad_token": "<pad>",
"eos_token": "<eos>",
"unk_token": "<unk>",
"mask_token": "<mask>",
}
def encode(
self,
sequence: str,
*,
add_special_tokens: bool = True,
return_batch_dim: bool = False,
dtype=mx.int32,
) -> mx.array:
"""
Convert a protein sequence into token IDs.
Args:
sequence: Protein sequence (case-insensitive).
add_special_tokens: If True, add <cls> at the start and <eos> at the end.
return_batch_dim: If True, output shape will be (1, L) instead of (L,).
dtype: MLX dtype for the returned array.
Returns:
mx.array: Token IDs of shape (L,) or (1, L).
"""
ids: List[int] = []
if add_special_tokens and self.prepend_bos:
ids.append(self.cls_id)
# Map each residue to its ID (defaulting to <unk> if not in vocab)
for ch in sequence.upper():
ids.append(self.token_to_id.get(ch, self.unk_id))
if add_special_tokens and self.append_eos:
ids.append(self.eos_id)
arr = mx.array(ids, dtype=dtype)
return mx.expand_dims(arr, axis=0) if return_batch_dim else arr
def batch_encode(
self,
sequences: Sequence[str],
*,
add_special_tokens: bool = True,
max_length: Optional[int] = None,
dtype=mx.int32,
) -> mx.array:
"""
Encode multiple protein sequences into a padded batch.
Args:
sequences: List/sequence of protein strings.
add_special_tokens: If True, add <cls> and <eos> tokens.
max_length: If provided, truncate sequences to this length before padding.
dtype: MLX dtype for the returned array.
Returns:
mx.array: Tensor of shape (B, L) with right-padding using <pad> IDs.
"""
# Encode each sequence as (L,)
encoded = [
self.encode(s, add_special_tokens=add_special_tokens, dtype=dtype)
for s in sequences
]
encoded = [e if e.ndim == 1 else e[0] for e in encoded]
if max_length is not None:
encoded = [e[:max_length] for e in encoded]
# Find the longest sequence and right-pad all others
max_len = max((int(e.shape[0]) for e in encoded), default=0)
padded = []
for e in encoded:
pad_len = max_len - int(e.shape[0])
if pad_len > 0:
pad = mx.full((pad_len,), self.pad_id, dtype=dtype)
e = mx.concatenate([e, pad], axis=0)
padded.append(e)
return mx.stack(padded, axis=0) if padded else mx.array([], dtype=dtype)
def decode(
self,
token_ids: ArrayLike,
*,
skip_special_tokens: bool = False,
) -> str:
"""
Convert token IDs back into a protein sequence string.
Args:
token_ids: 1-D or 2-D array/list of IDs. If 2-D, only the first row is decoded.
skip_special_tokens: If True, remove all special tokens from output.
Returns:
str: Protein sequence.
"""
# Normalize to a 1-D MLX array
if hasattr(token_ids, "shape") and hasattr(token_ids, "tolist"):
ids = token_ids if token_ids.ndim == 1 else token_ids[0]
else:
ids = mx.array(token_ids, dtype=mx.int32)
ids_list = [int(x) for x in ids.tolist()]
toks: List[str] = []
for i in ids_list:
tok = self.id_to_token.get(i, "<unk>")
if skip_special_tokens and tok in {
"<cls>",
"<pad>",
"<eos>",
"<unk>",
"<mask>",
}:
continue
toks.append(tok)
return "".join(toks)
def __len__(self) -> int:
"""Return the size of the tokenizers vocabulary."""
return len(self.vocab)

View File

@@ -1,81 +0,0 @@
import argparse
import mlx.core as mx
from esm import ESM2
def main():
parser = argparse.ArgumentParser(description="ESM-2 MLX Inference")
parser.add_argument(
"--model-path",
default="checkpoints/mlx-esm2_t33_650M_UR50D",
help="Path to MLX model checkpoint",
)
parser.add_argument(
"--sequence",
default="MALWMRLLPLLALLALWGPDPAAAFVNQHLCGSHLVEALYLVCGERGFFYTPKTRREAEDLQVGQVELGGGPGAGSLQPLALEGSLQKRGIVEQCCTSICSLYQLENYCN",
help="Protein sequence to test (default: human insulin)",
)
parser.add_argument(
"--mask-position",
type=int,
default=None,
help="Position to mask (default: middle of sequence)",
)
args = parser.parse_args()
# Load pretrained ESM-2 model and tokenizer
tokenizer, model = ESM2.from_pretrained(args.model_path)
# Determine sequence and position to mask
sequence = args.sequence.upper()
mask_pos = (
args.mask_position if args.mask_position is not None else len(sequence) // 2
)
if mask_pos >= len(sequence):
mask_pos = len(sequence) - 1
original_aa = sequence[mask_pos] # The original amino acid at masked position
# Display input info
print(f"Original sequence: {sequence}")
print(f"Masked sequence: {sequence[:mask_pos]}<mask>{sequence[mask_pos+1:]}")
print(f"Predicting position {mask_pos}: {original_aa}\n")
# Tokenize sequence before and after the mask
before = tokenizer.encode(sequence[:mask_pos], add_special_tokens=False)
after = tokenizer.encode(sequence[mask_pos + 1 :], add_special_tokens=False)
# Build token sequence with <cls>, <mask>, and <eos>
tokens = mx.array(
[
[tokenizer.cls_id]
+ before.tolist()
+ [tokenizer.mask_id]
+ after.tolist()
+ [tokenizer.eos_id]
]
)
mask_token_pos = 1 + len(before) # Position of <mask> token
# Run model to get logits for each token position
logits = model(tokens)["logits"]
probs = mx.softmax(
logits[0, mask_token_pos, :]
) # Softmax over vocabulary at mask position
# Get top-5 most likely tokens
top_indices = mx.argsort(probs)[-5:][::-1]
# Print predictions
print("Top predictions:")
for i, idx in enumerate(top_indices):
token = tokenizer.vocab[int(idx)]
if token in tokenizer.vocab:
prob = float(probs[idx])
marker = "" if token == original_aa else " "
print(f"{marker} {i+1}. {token}: {prob:.3f} ({prob*100:.1f}%)")
if __name__ == "__main__":
main()

File diff suppressed because one or more lines are too long

File diff suppressed because one or more lines are too long

File diff suppressed because one or more lines are too long

View File

@@ -1,12 +0,0 @@
mlx
torch
transformers
numpy
pandas
seaborn
biopython
biotite
scipy
tqdm
scikit-learn
matplotlib

View File

@@ -1,121 +0,0 @@
import unittest
import numpy as np
from transformers import AutoTokenizer, EsmConfig, EsmForMaskedLM
from esm import ESM2
# Paths for MLX and Hugging Face versions of ESM-2
MLX_PATH = "checkpoints/mlx-esm2_t12_35M_UR50D"
HF_PATH = "facebook/esm2_t12_35M_UR50D"
def load_mlx_model():
"""Load MLX ESM-2 model and tokenizer."""
tokenizer, model = ESM2.from_pretrained(MLX_PATH)
return tokenizer, model
def load_hf_model():
"""Load Hugging Face ESM-2 model and tokenizer with hidden states + attentions."""
tokenizer = AutoTokenizer.from_pretrained(HF_PATH)
config = EsmConfig.from_pretrained(
HF_PATH, output_hidden_states=True, output_attentions=True
)
model = EsmForMaskedLM.from_pretrained(HF_PATH, config=config)
return tokenizer, model
class TestESM2(unittest.TestCase):
@classmethod
def setUpClass(cls):
# Load both MLX and HF models/tokenizers once for all tests
cls.mlx_tokenizer, cls.mlx_model = load_mlx_model()
cls.hf_tokenizer, cls.hf_model = load_hf_model()
def test_tokenizer(self):
"""Verify MLX tokenizer matches Hugging Face tokenizer behavior."""
self.assertEqual(len(self.mlx_tokenizer), len(self.hf_tokenizer))
sequences = [
"MSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVTTFSYGVQCFSRYPDHMKQHDFFKSAMPEGYVQERTIFFKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYNSHNVYIMADKQKNGIKVNFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSTQSALSKDPNEKRDHMVLLEFVTAAGITHGMDELYK",
"MALWMRLLPLLALLALWGPDPAAAFVNQHLCGSHLVEALYLVCGERGFFYTPKTRREAEDLQVGQVELGGGPGAGSLQPLALEGSLQKRGIVEQCCTSICSLYQLENYCN",
]
# Compare batched tokenization (padded sequences)
mlx_batch = self.mlx_tokenizer.batch_encode(sequences)
hf_batch = (
self.hf_tokenizer(sequences, return_tensors="pt", padding=True)["input_ids"]
.cpu()
.numpy()
)
self.assertEqual(tuple(mlx_batch.shape), tuple(hf_batch.shape))
self.assertTrue(
np.array_equal(np.array(mlx_batch.tolist(), dtype=hf_batch.dtype), hf_batch)
)
# Compare single-sequence encode/decode
for sequence in sequences:
mlx_tokens = self.mlx_tokenizer.encode(sequence)
hf_tokens = (
self.hf_tokenizer(sequence, return_tensors="pt")["input_ids"]
.cpu()
.numpy()
.tolist()[0]
)
self.assertTrue(np.array_equal(mlx_tokens, hf_tokens))
self.assertEqual(
self.mlx_tokenizer.decode(mlx_tokens),
self.hf_tokenizer.decode(hf_tokens).replace(" ", ""),
)
self.assertEqual(
self.mlx_tokenizer.decode(mlx_tokens, skip_special_tokens=True),
self.hf_tokenizer.decode(hf_tokens, skip_special_tokens=True).replace(
" ", ""
),
)
def test_model(self):
"""Verify MLX and HF model outputs match (logits, hidden states, attentions)."""
sequences = [
"MSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVTTFSYGVQCFSRYPDHMKQHDFFKSAMPEGYVQERTIFFKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYNSHNVYIMADKQKNGIKVNFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSTQSALSKDPNEKRDHMVLLEFVTAAGITHGMDELYK",
"MALWMRLLPLLALLALWGPDPAAAFVNQHLCGSHLVEALYLVCGERGFFYTPKTRREAEDLQVGQVELGGGPGAGSLQPLALEGSLQKRGIVEQCCTSICSLYQLENYCN",
]
for sequence in sequences:
# Tokenize
mlx_tokens = self.mlx_tokenizer.encode(sequence, return_batch_dim=True)
hf_tokens = self.hf_tokenizer(sequence, return_tensors="pt")["input_ids"]
# Forward pass
mlx_outputs = self.mlx_model(
mlx_tokens,
repr_layers=[self.mlx_model.num_layers],
need_head_weights=True,
)
hf_outputs = self.hf_model(input_ids=hf_tokens)
# Compare logits
mlx_logits = np.array(mlx_outputs["logits"])
hf_logits = hf_outputs["logits"].detach().cpu().numpy()
self.assertTrue(np.allclose(mlx_logits, hf_logits, rtol=1e-4, atol=1e-4))
# Compare final-layer hidden states
final_layer = self.mlx_model.num_layers
mlx_hidden_states = np.array(mlx_outputs["representations"][final_layer])
hf_hidden_states = hf_outputs["hidden_states"][-1].detach().cpu().numpy()
self.assertTrue(
np.allclose(mlx_hidden_states, hf_hidden_states, rtol=1e-4, atol=1e-4)
)
# Compare attentions for final layer
mlx_attentions = np.array(
mlx_outputs["attentions"][:, final_layer - 1, :, :, :]
)
hf_attentions = hf_outputs["attentions"][-1].detach().cpu().numpy()
self.assertTrue(
np.allclose(mlx_attentions, hf_attentions, rtol=1e-4, atol=1e-4)
)
if __name__ == "__main__":
unittest.main()

View File

@@ -1,281 +0,0 @@
FLUX
====
FLUX implementation in MLX. The implementation is ported directly from
[https://github.com/black-forest-labs/flux](https://github.com/black-forest-labs/flux)
and the model weights are downloaded directly from the Hugging Face Hub.
The goal of this example is to be clean, educational and to allow for
experimentation with finetuning FLUX models as well as adding extra
functionality such as in-/outpainting, guidance with custom losses etc.
![MLX image](static/generated-mlx.png)
*Image generated using FLUX-dev in MLX and the prompt 'An image in the style of
tron emanating futuristic technology with the word "MLX" in the center with
capital red letters.'*
Installation
------------
The dependencies are minimal, namely:
- `huggingface-hub` to download the checkpoints.
- `regex` for the tokenization
- `tqdm`, `PIL`, and `numpy` for the scripts
- `sentencepiece` for the T5 tokenizer
- `datasets` for using an HF dataset directly
You can install all of the above with the `requirements.txt` as follows:
pip install -r requirements.txt
Usage
---------
You can use the following command to generate an image, using `--output` to specify the storage location of the image, defaulting to `out.png`.
```shell
python txt2image.py --model schnell \
--n-images 1 \
--image-size 256x512 \
--verbose \
'A photo of an astronaut riding a horse on Mars.'
```
For more parameters, please use the `--help` command to view.
```shell
python txt2image.py --help
```
Inference
---------
Inference in this example is similar to the stable diffusion example. The
classes to get you started are `FluxPipeline` from the `flux` module.
```python
import mlx.core as mx
from flux import FluxPipeline
# This will download all the weights from HF hub
flux = FluxPipeline("flux-schnell")
# Make a generator that returns the latent variables from the reverse diffusion
# process
latent_generator = flux.generate_latents(
"A photo of an astronaut riding a horse on Mars",
num_steps=4,
latent_size=(32, 64), # 256x512 image
)
# The first return value of the generator contains the conditioning and the
# random noise at the beginning of the diffusion process.
conditioning = next(latent_generator)
(
x_T, # The initial noise
x_positions, # The integer positions used for image positional encoding
t5_conditioning, # The T5 features from the text prompt
t5_positions, # Integer positions for text (normally all 0s)
clip_conditioning, # The clip text features from the text prompt
) = conditioning
# Returning the conditioning as the first output from the generator allows us
# to unload T5 and clip before running the diffusion transformer.
mx.eval(conditioning)
# Evaluate each diffusion step
for x_t in latent_generator:
mx.eval(x_t)
# Note that we need to pass the latent size because it is collapsed and
# patchified in x_t and we need to unwrap it.
img = flux.decode(x_t, latent_size=(32, 64))
```
The above are essentially the implementation of the `txt2image.py` script
except for some additional logic to quantize and/or load trained adapters. One
can use the script as follows:
```shell
python txt2image.py \
--n-images 4 \
--n-rows 2 \
--image-size 256x512 \
'A photo of an astronaut riding a horse on Mars.'
```
### Experimental Options
FLUX pads the prompt to a specific size of 512 tokens for the dev model and
256 for the schnell model. Not applying padding results in faster generation
but it is not clear how it may affect the generated images. To enable that
option in this example pass `--no-t5-padding` to the `txt2image.py` script or
instantiate the pipeline with `FluxPipeline("flux-schnell", t5_padding=False)`.
Finetuning
----------
The `dreambooth.py` script supports LoRA finetuning of FLUX-dev (and schnell
but ymmv) on a provided image dataset. The dataset folder must have an
`train.jsonl` file with the following format:
```jsonl
{"image": "path-to-image-relative-to-dataset", "prompt": "Prompt to use with this image"}
{"image": "path-to-image-relative-to-dataset", "prompt": "Prompt to use with this image"}
...
```
The training script by default trains for 600 iterations with a batch size of
1, gradient accumulation of 4 and LoRA rank of 8. Run `python dreambooth.py
--help` for the list of hyperparameters you can tune.
> [!Note]
> FLUX finetuning requires approximately 50GB of RAM. QLoRA is coming soon and
> should reduce this number significantly.
### Training Example
This is a step-by-step finetuning example. We will be using the data from
[https://github.com/google/dreambooth](https://github.com/google/dreambooth).
In particular, we will use `dog6` which is a popular example for showcasing
dreambooth [^1].
The training images are the following 5 images [^2]:
![dog6](static/dog6.png)
We start by making the following `train.jsonl` file and placing it in the same
folder as the images.
```jsonl
{"image": "00.jpg", "prompt": "A photo of sks dog"}
{"image": "01.jpg", "prompt": "A photo of sks dog"}
{"image": "02.jpg", "prompt": "A photo of sks dog"}
{"image": "03.jpg", "prompt": "A photo of sks dog"}
{"image": "04.jpg", "prompt": "A photo of sks dog"}
```
Subsequently we finetune FLUX using the following command:
```shell
python dreambooth.py \
--progress-prompt 'A photo of an sks dog lying on the sand at a beach in Greece' \
--progress-every 600 --iterations 1200 --learning-rate 0.0001 \
--lora-rank 4 --grad-accumulate 8 \
path/to/dreambooth/dataset/dog6
```
Or you can directly use the pre-processed Hugging Face dataset
[mlx-community/dreambooth-dog6](https://huggingface.co/datasets/mlx-community/dreambooth-dog6)
for fine-tuning.
```shell
python dreambooth.py \
--progress-prompt 'A photo of an sks dog lying on the sand at a beach in Greece' \
--progress-every 600 --iterations 1200 --learning-rate 0.0001 \
--lora-rank 4 --grad-accumulate 8 \
mlx-community/dreambooth-dog6
```
The training requires approximately 50GB of RAM and on an M2 Ultra it takes a
bit more than 1 hour.
### Using the Adapter
The adapters are saved in `mlx_output` and can be used directly by the
`txt2image.py` script. For instance,
```shell
python txt2image.py --model dev --save-raw --image-size 512x512 --n-images 1 \
--adapter mlx_output/final_adapters.safetensors \
--fuse-adapter \
--no-t5-padding \
'A photo of an sks dog lying on the sand at a beach in Greece'
```
generates an image that looks like the following,
![dog image](static/dog-r4-g8-1200.png)
and of course we can pass `--image-size 512x1024` to get larger images with
different aspect ratios,
![wide dog image](static/dog-r4-g8-1200-512x1024.png)
The arguments that are relevant to the adapters are of course `--adapter` and
`--fuse-adapter`. The first defines the path to an adapter to apply to the
model and the second fuses the adapter back into the model to get a bit more
speed during generation.
[^1]: Refer to the [arXiv paper](https://arxiv.org/abs/2208.12242) for more details.
[^2]: The images are from unsplash by https://unsplash.com/@alvannee .
Distributed Computation
------------------------
The FLUX example supports distributed computation during both generation and
training. See the [distributed communication
documentation](https://ml-explore.github.io/mlx/build/html/usage/distributed.html)
for information on how to set-up MLX for distributed communication. The rest of
this section assumes you can launch distributed MLX programs using `mlx.launch
--hostfile hostfile.json`.
### Distributed Finetuning
Distributed finetuning scales very well with FLUX and all one has to do is
adjust the gradient accumulation and training iterations so that the batch
size remains the same. For instance, to replicate the following training
```shell
python dreambooth.py \
--progress-prompt 'A photo of an sks dog lying on the sand at a beach in Greece' \
--progress-every 600 --iterations 1200 --learning-rate 0.0001 \
--lora-rank 4 --grad-accumulate 8 \
mlx-community/dreambooth-dog6
```
On 4 machines we simply run
```shell
mlx.launch --verbose --hostfile hostfile.json -- python dreambooth.py \
--progress-prompt 'A photo of an sks dog lying on the sand at a beach in Greece' \
--progress-every 150 --iterations 300 --learning-rate 0.0001 \
--lora-rank 4 --grad-accumulate 2 \
mlx-community/dreambooth-dog6
```
Note the iterations that changed to 300 from 1200 and the gradient accumulations to 2 from 8.
### Distributed Inference
Distributed inference can be divided in two different approaches. The first
approach is the data-parallel approach, where each node generates its own
images and shares them at the end. The second approach is the model-parallel
approach where the model is shared across the nodes and they collaboratively
generate the images.
The `txt2image.py` script will attempt to choose the best approach depending on
how many images are being generated across the nodes. The model-parallel
approach can be forced by passing the argument `--force-shard`.
For better performance in the model-parallel approach we suggest that you use a
[thunderbolt
ring](https://ml-explore.github.io/mlx/build/html/usage/distributed.html#getting-started-with-ring).
All you have to do once again is use `mlx.launch` as follows
```shell
mlx.launch --verbose --hostfile hostfile.json -- \
python txt2image.py --model schnell \
--n-images 8 \
--image-size 512x512 \
--verbose \
'A photo of an astronaut riding a horse on Mars'
```
for model-parallel generation you may want to also pass `--env
MLX_METAL_FAST_SYNCH=1` to `mlx.launch` which is an experimental setting that
reduces the CPU/GPU synchronization overhead.

View File

@@ -1,292 +0,0 @@
# Copyright © 2024 Apple Inc.
import argparse
import time
from functools import partial
from pathlib import Path
import mlx.core as mx
import mlx.nn as nn
import mlx.optimizers as optim
import numpy as np
from mlx.nn.utils import average_gradients
from mlx.utils import tree_flatten, tree_map, tree_reduce
from PIL import Image
from flux import FluxPipeline, Trainer, load_dataset, save_config
def generate_progress_images(iteration, flux, args):
"""Generate images to monitor the progress of the finetuning."""
out_dir = Path(args.output_dir)
out_dir.mkdir(parents=True, exist_ok=True)
out_file = out_dir / f"{iteration:07d}_progress.png"
print(f"Generating {str(out_file)}", flush=True)
# Generate some images and arrange them in a grid
n_rows = 2
n_images = 4
x = flux.generate_images(
args.progress_prompt,
n_images,
args.progress_steps,
)
x = mx.pad(x, [(0, 0), (4, 4), (4, 4), (0, 0)])
B, H, W, C = x.shape
x = x.reshape(n_rows, B // n_rows, H, W, C).transpose(0, 2, 1, 3, 4)
x = x.reshape(n_rows * H, B // n_rows * W, C)
x = mx.pad(x, [(4, 4), (4, 4), (0, 0)])
x = (x * 255).astype(mx.uint8)
# Save them to disc
im = Image.fromarray(np.array(x))
im.save(out_file)
def save_adapters(adapter_name, flux, args):
out_dir = Path(args.output_dir)
out_dir.mkdir(parents=True, exist_ok=True)
out_file = out_dir / adapter_name
print(f"Saving {str(out_file)}")
mx.save_safetensors(
str(out_file),
dict(tree_flatten(flux.flow.trainable_parameters())),
metadata={
"lora_rank": str(args.lora_rank),
"lora_blocks": str(args.lora_blocks),
},
)
def setup_arg_parser():
"""Set up and return the argument parser."""
parser = argparse.ArgumentParser(
description="Finetune Flux to generate images with a specific subject"
)
parser.add_argument(
"--model",
default="dev",
choices=[
"dev",
"schnell",
],
help="Which flux model to train",
)
parser.add_argument(
"--guidance", type=float, default=4.0, help="The guidance factor to use."
)
parser.add_argument(
"--iterations",
type=int,
default=600,
help="How many iterations to train for",
)
parser.add_argument(
"--batch-size",
type=int,
default=1,
help="The batch size to use when training the stable diffusion model",
)
parser.add_argument(
"--resolution",
type=lambda x: tuple(map(int, x.split("x"))),
default=(512, 512),
help="The resolution of the training images",
)
parser.add_argument(
"--num-augmentations",
type=int,
default=5,
help="Augment the images by random cropping and panning",
)
parser.add_argument(
"--progress-prompt",
required=True,
help="Use this prompt when generating images for evaluation",
)
parser.add_argument(
"--progress-steps",
type=int,
default=50,
help="Use this many steps when generating images for evaluation",
)
parser.add_argument(
"--progress-every",
type=int,
default=50,
help="Generate images every PROGRESS_EVERY steps",
)
parser.add_argument(
"--checkpoint-every",
type=int,
default=50,
help="Save the model every CHECKPOINT_EVERY steps",
)
parser.add_argument(
"--lora-blocks",
type=int,
default=-1,
help="Train the last LORA_BLOCKS transformer blocks",
)
parser.add_argument(
"--lora-rank", type=int, default=8, help="LoRA rank for finetuning"
)
parser.add_argument(
"--warmup-steps", type=int, default=100, help="Learning rate warmup"
)
parser.add_argument(
"--learning-rate", type=float, default="1e-4", help="Learning rate for training"
)
parser.add_argument(
"--grad-accumulate",
type=int,
default=4,
help="Accumulate gradients for that many iterations before applying them",
)
parser.add_argument(
"--output-dir", default="mlx_output", help="Folder to save the checkpoints in"
)
parser.add_argument("dataset")
return parser
if __name__ == "__main__":
parser = setup_arg_parser()
args = parser.parse_args()
output_path = Path(args.output_dir)
output_path.mkdir(parents=True, exist_ok=True)
save_config(vars(args), output_path / "adapter_config.json")
# Load the model and set it up for LoRA training. We use the same random
# state when creating the LoRA layers so all workers will have the same
# initial weights.
mx.random.seed(0x0F0F0F0F)
flux = FluxPipeline("flux-" + args.model)
flux.flow.freeze()
flux.linear_to_lora_layers(args.lora_rank, args.lora_blocks)
# Reset the seed to a different seed per worker if we are in distributed
# mode so that each worker is working on different data, diffusion step and
# random noise.
mx.random.seed(0xF0F0F0F0 + mx.distributed.init().rank())
# Report how many parameters we are training
trainable_params = tree_reduce(
lambda acc, x: acc + x.size, flux.flow.trainable_parameters(), 0
)
print(f"Training {trainable_params / 1024 ** 2:.3f}M parameters", flush=True)
# Set up the optimizer and training steps. The steps are a bit verbose to
# support gradient accumulation together with compilation.
warmup = optim.linear_schedule(0, args.learning_rate, args.warmup_steps)
cosine = optim.cosine_decay(
args.learning_rate, args.iterations // args.grad_accumulate
)
lr_schedule = optim.join_schedules([warmup, cosine], [args.warmup_steps])
optimizer = optim.Adam(learning_rate=lr_schedule)
state = [flux.flow.state, optimizer.state, mx.random.state]
@partial(mx.compile, inputs=state, outputs=state)
def single_step(x, t5_feat, clip_feat, guidance):
loss, grads = nn.value_and_grad(flux.flow, flux.training_loss)(
x, t5_feat, clip_feat, guidance
)
grads = average_gradients(grads)
optimizer.update(flux.flow, grads)
return loss
@partial(mx.compile, inputs=state, outputs=state)
def compute_loss_and_grads(x, t5_feat, clip_feat, guidance):
return nn.value_and_grad(flux.flow, flux.training_loss)(
x, t5_feat, clip_feat, guidance
)
@partial(mx.compile, inputs=state, outputs=state)
def compute_loss_and_accumulate_grads(x, t5_feat, clip_feat, guidance, prev_grads):
loss, grads = nn.value_and_grad(flux.flow, flux.training_loss)(
x, t5_feat, clip_feat, guidance
)
grads = tree_map(lambda a, b: a + b, prev_grads, grads)
return loss, grads
@partial(mx.compile, inputs=state, outputs=state)
def grad_accumulate_and_step(x, t5_feat, clip_feat, guidance, prev_grads):
loss, grads = nn.value_and_grad(flux.flow, flux.training_loss)(
x, t5_feat, clip_feat, guidance
)
grads = tree_map(
lambda a, b: (a + b) / args.grad_accumulate,
prev_grads,
grads,
)
grads = average_gradients(grads)
optimizer.update(flux.flow, grads)
return loss
# We simply route to the appropriate step based on whether we have
# gradients from a previous step and whether we should be performing an
# update or simply computing and accumulating gradients in this step.
def step(x, t5_feat, clip_feat, guidance, prev_grads, perform_step):
if prev_grads is None:
if perform_step:
return single_step(x, t5_feat, clip_feat, guidance), None
else:
return compute_loss_and_grads(x, t5_feat, clip_feat, guidance)
else:
if perform_step:
return (
grad_accumulate_and_step(
x, t5_feat, clip_feat, guidance, prev_grads
),
None,
)
else:
return compute_loss_and_accumulate_grads(
x, t5_feat, clip_feat, guidance, prev_grads
)
dataset = load_dataset(args.dataset)
trainer = Trainer(flux, dataset, args)
trainer.encode_dataset()
guidance = mx.full((args.batch_size,), args.guidance, dtype=flux.dtype)
# An initial generation to compare
generate_progress_images(0, flux, args)
grads = None
losses = []
tic = time.time()
for i, batch in zip(range(args.iterations), trainer.iterate(args.batch_size)):
loss, grads = step(*batch, guidance, grads, (i + 1) % args.grad_accumulate == 0)
mx.eval(loss, grads, state)
losses.append(loss.item())
if (i + 1) % 10 == 0:
toc = time.time()
peak_mem = mx.metal.get_peak_memory() / 1024**3
print(
f"Iter: {i + 1} Loss: {sum(losses) / 10:.3f} "
f"It/s: {10 / (toc - tic):.3f} "
f"Peak mem: {peak_mem:.3f} GB",
flush=True,
)
if (i + 1) % args.progress_every == 0:
generate_progress_images(i + 1, flux, args)
if (i + 1) % args.checkpoint_every == 0:
save_adapters(f"{i + 1:07d}_adapters.safetensors", flux, args)
if (i + 1) % 10 == 0:
losses = []
tic = time.time()
save_adapters("final_adapters.safetensors", flux, args)
print("Training successful.")

View File

@@ -1,16 +0,0 @@
# Copyright © 2024 Apple Inc.
from .datasets import Dataset, load_dataset
from .flux import FluxPipeline
from .lora import LoRALinear
from .sampler import FluxSampler
from .trainer import Trainer
from .utils import (
load_ae,
load_clip,
load_clip_tokenizer,
load_flow_model,
load_t5,
load_t5_tokenizer,
save_config,
)

View File

@@ -1,357 +0,0 @@
# Copyright © 2024 Apple Inc.
from dataclasses import dataclass
from typing import List
import mlx.core as mx
import mlx.nn as nn
from mlx.nn.layers.upsample import upsample_nearest
@dataclass
class AutoEncoderParams:
resolution: int
in_channels: int
ch: int
out_ch: int
ch_mult: List[int]
num_res_blocks: int
z_channels: int
scale_factor: float
shift_factor: float
class AttnBlock(nn.Module):
def __init__(self, in_channels: int):
super().__init__()
self.in_channels = in_channels
self.norm = nn.GroupNorm(
num_groups=32,
dims=in_channels,
eps=1e-6,
affine=True,
pytorch_compatible=True,
)
self.q = nn.Linear(in_channels, in_channels)
self.k = nn.Linear(in_channels, in_channels)
self.v = nn.Linear(in_channels, in_channels)
self.proj_out = nn.Linear(in_channels, in_channels)
def __call__(self, x: mx.array) -> mx.array:
B, H, W, C = x.shape
y = x.reshape(B, 1, -1, C)
y = self.norm(y)
q = self.q(y)
k = self.k(y)
v = self.v(y)
y = mx.fast.scaled_dot_product_attention(q, k, v, scale=C ** (-0.5))
y = self.proj_out(y)
return x + y.reshape(B, H, W, C)
class ResnetBlock(nn.Module):
def __init__(self, in_channels: int, out_channels: int):
super().__init__()
self.in_channels = in_channels
out_channels = in_channels if out_channels is None else out_channels
self.out_channels = out_channels
self.norm1 = nn.GroupNorm(
num_groups=32,
dims=in_channels,
eps=1e-6,
affine=True,
pytorch_compatible=True,
)
self.conv1 = nn.Conv2d(
in_channels, out_channels, kernel_size=3, stride=1, padding=1
)
self.norm2 = nn.GroupNorm(
num_groups=32,
dims=out_channels,
eps=1e-6,
affine=True,
pytorch_compatible=True,
)
self.conv2 = nn.Conv2d(
out_channels, out_channels, kernel_size=3, stride=1, padding=1
)
if self.in_channels != self.out_channels:
self.nin_shortcut = nn.Linear(in_channels, out_channels)
def __call__(self, x):
h = x
h = self.norm1(h)
h = nn.silu(h)
h = self.conv1(h)
h = self.norm2(h)
h = nn.silu(h)
h = self.conv2(h)
if self.in_channels != self.out_channels:
x = self.nin_shortcut(x)
return x + h
class Downsample(nn.Module):
def __init__(self, in_channels: int):
super().__init__()
self.conv = nn.Conv2d(
in_channels, in_channels, kernel_size=3, stride=2, padding=0
)
def __call__(self, x: mx.array):
x = mx.pad(x, [(0, 0), (0, 1), (0, 1), (0, 0)])
x = self.conv(x)
return x
class Upsample(nn.Module):
def __init__(self, in_channels: int):
super().__init__()
self.conv = nn.Conv2d(
in_channels, in_channels, kernel_size=3, stride=1, padding=1
)
def __call__(self, x: mx.array):
x = upsample_nearest(x, (2, 2))
x = self.conv(x)
return x
class Encoder(nn.Module):
def __init__(
self,
resolution: int,
in_channels: int,
ch: int,
ch_mult: list[int],
num_res_blocks: int,
z_channels: int,
):
super().__init__()
self.ch = ch
self.num_resolutions = len(ch_mult)
self.num_res_blocks = num_res_blocks
self.resolution = resolution
self.in_channels = in_channels
# downsampling
self.conv_in = nn.Conv2d(
in_channels, self.ch, kernel_size=3, stride=1, padding=1
)
curr_res = resolution
in_ch_mult = (1,) + tuple(ch_mult)
self.in_ch_mult = in_ch_mult
self.down = []
block_in = self.ch
for i_level in range(self.num_resolutions):
block = []
attn = [] # TODO: Remove the attn, nobody appends anything to it
block_in = ch * in_ch_mult[i_level]
block_out = ch * ch_mult[i_level]
for _ in range(self.num_res_blocks):
block.append(ResnetBlock(in_channels=block_in, out_channels=block_out))
block_in = block_out
down = {}
down["block"] = block
down["attn"] = attn
if i_level != self.num_resolutions - 1:
down["downsample"] = Downsample(block_in)
curr_res = curr_res // 2
self.down.append(down)
# middle
self.mid = {}
self.mid["block_1"] = ResnetBlock(in_channels=block_in, out_channels=block_in)
self.mid["attn_1"] = AttnBlock(block_in)
self.mid["block_2"] = ResnetBlock(in_channels=block_in, out_channels=block_in)
# end
self.norm_out = nn.GroupNorm(
num_groups=32, dims=block_in, eps=1e-6, affine=True, pytorch_compatible=True
)
self.conv_out = nn.Conv2d(
block_in, 2 * z_channels, kernel_size=3, stride=1, padding=1
)
def __call__(self, x: mx.array):
hs = [self.conv_in(x)]
for i_level in range(self.num_resolutions):
for i_block in range(self.num_res_blocks):
h = self.down[i_level]["block"][i_block](hs[-1])
# TODO: Remove the attn
if len(self.down[i_level]["attn"]) > 0:
h = self.down[i_level]["attn"][i_block](h)
hs.append(h)
if i_level != self.num_resolutions - 1:
hs.append(self.down[i_level]["downsample"](hs[-1]))
# middle
h = hs[-1]
h = self.mid["block_1"](h)
h = self.mid["attn_1"](h)
h = self.mid["block_2"](h)
# end
h = self.norm_out(h)
h = nn.silu(h)
h = self.conv_out(h)
return h
class Decoder(nn.Module):
def __init__(
self,
ch: int,
out_ch: int,
ch_mult: list[int],
num_res_blocks: int,
in_channels: int,
resolution: int,
z_channels: int,
):
super().__init__()
self.ch = ch
self.num_resolutions = len(ch_mult)
self.num_res_blocks = num_res_blocks
self.resolution = resolution
self.in_channels = in_channels
self.ffactor = 2 ** (self.num_resolutions - 1)
# compute in_ch_mult, block_in and curr_res at lowest res
block_in = ch * ch_mult[self.num_resolutions - 1]
curr_res = resolution // 2 ** (self.num_resolutions - 1)
self.z_shape = (1, z_channels, curr_res, curr_res)
# z to block_in
self.conv_in = nn.Conv2d(
z_channels, block_in, kernel_size=3, stride=1, padding=1
)
# middle
self.mid = {}
self.mid["block_1"] = ResnetBlock(in_channels=block_in, out_channels=block_in)
self.mid["attn_1"] = AttnBlock(block_in)
self.mid["block_2"] = ResnetBlock(in_channels=block_in, out_channels=block_in)
# upsampling
self.up = []
for i_level in reversed(range(self.num_resolutions)):
block = []
attn = [] # TODO: Remove the attn, nobody appends anything to it
block_out = ch * ch_mult[i_level]
for _ in range(self.num_res_blocks + 1):
block.append(ResnetBlock(in_channels=block_in, out_channels=block_out))
block_in = block_out
up = {}
up["block"] = block
up["attn"] = attn
if i_level != 0:
up["upsample"] = Upsample(block_in)
curr_res = curr_res * 2
self.up.insert(0, up) # prepend to get consistent order
# end
self.norm_out = nn.GroupNorm(
num_groups=32, dims=block_in, eps=1e-6, affine=True, pytorch_compatible=True
)
self.conv_out = nn.Conv2d(block_in, out_ch, kernel_size=3, stride=1, padding=1)
def __call__(self, z: mx.array):
# z to block_in
h = self.conv_in(z)
# middle
h = self.mid["block_1"](h)
h = self.mid["attn_1"](h)
h = self.mid["block_2"](h)
# upsampling
for i_level in reversed(range(self.num_resolutions)):
for i_block in range(self.num_res_blocks + 1):
h = self.up[i_level]["block"][i_block](h)
# TODO: Remove the attn
if len(self.up[i_level]["attn"]) > 0:
h = self.up[i_level]["attn"][i_block](h)
if i_level != 0:
h = self.up[i_level]["upsample"](h)
# end
h = self.norm_out(h)
h = nn.silu(h)
h = self.conv_out(h)
return h
class DiagonalGaussian(nn.Module):
def __call__(self, z: mx.array):
mean, logvar = mx.split(z, 2, axis=-1)
if self.training:
std = mx.exp(0.5 * logvar)
eps = mx.random.normal(shape=z.shape, dtype=z.dtype)
return mean + std * eps
else:
return mean
class AutoEncoder(nn.Module):
def __init__(self, params: AutoEncoderParams):
super().__init__()
self.encoder = Encoder(
resolution=params.resolution,
in_channels=params.in_channels,
ch=params.ch,
ch_mult=params.ch_mult,
num_res_blocks=params.num_res_blocks,
z_channels=params.z_channels,
)
self.decoder = Decoder(
resolution=params.resolution,
in_channels=params.in_channels,
ch=params.ch,
out_ch=params.out_ch,
ch_mult=params.ch_mult,
num_res_blocks=params.num_res_blocks,
z_channels=params.z_channels,
)
self.reg = DiagonalGaussian()
self.scale_factor = params.scale_factor
self.shift_factor = params.shift_factor
def sanitize(self, weights):
new_weights = {}
for k, w in weights.items():
if w.ndim == 4:
w = w.transpose(0, 2, 3, 1)
w = w.reshape(-1).reshape(w.shape)
if w.shape[1:3] == (1, 1):
w = w.squeeze((1, 2))
new_weights[k] = w
return new_weights
def encode(self, x: mx.array):
z = self.reg(self.encoder(x))
z = self.scale_factor * (z - self.shift_factor)
return z
def decode(self, z: mx.array):
z = z / self.scale_factor + self.shift_factor
return self.decoder(z)
def __call__(self, x: mx.array):
return self.decode(self.encode(x))

View File

@@ -1,154 +0,0 @@
# Copyright © 2024 Apple Inc.
from dataclasses import dataclass
from typing import List, Optional
import mlx.core as mx
import mlx.nn as nn
_ACTIVATIONS = {"quick_gelu": nn.gelu_fast_approx, "gelu": nn.gelu}
@dataclass
class CLIPTextModelConfig:
num_layers: int = 23
model_dims: int = 1024
num_heads: int = 16
max_length: int = 77
vocab_size: int = 49408
hidden_act: str = "quick_gelu"
@classmethod
def from_dict(cls, config):
return cls(
num_layers=config["num_hidden_layers"],
model_dims=config["hidden_size"],
num_heads=config["num_attention_heads"],
max_length=config["max_position_embeddings"],
vocab_size=config["vocab_size"],
hidden_act=config["hidden_act"],
)
@dataclass
class CLIPOutput:
# The last_hidden_state indexed at the EOS token and possibly projected if
# the model has a projection layer
pooled_output: Optional[mx.array] = None
# The full sequence output of the transformer after the final layernorm
last_hidden_state: Optional[mx.array] = None
# A list of hidden states corresponding to the outputs of the transformer layers
hidden_states: Optional[List[mx.array]] = None
class CLIPEncoderLayer(nn.Module):
"""The transformer encoder layer from CLIP."""
def __init__(self, model_dims: int, num_heads: int, activation: str):
super().__init__()
self.layer_norm1 = nn.LayerNorm(model_dims)
self.layer_norm2 = nn.LayerNorm(model_dims)
self.attention = nn.MultiHeadAttention(model_dims, num_heads, bias=True)
self.linear1 = nn.Linear(model_dims, 4 * model_dims)
self.linear2 = nn.Linear(4 * model_dims, model_dims)
self.act = _ACTIVATIONS[activation]
def __call__(self, x, attn_mask=None):
y = self.layer_norm1(x)
y = self.attention(y, y, y, attn_mask)
x = y + x
y = self.layer_norm2(x)
y = self.linear1(y)
y = self.act(y)
y = self.linear2(y)
x = y + x
return x
class CLIPTextModel(nn.Module):
"""Implements the text encoder transformer from CLIP."""
def __init__(self, config: CLIPTextModelConfig):
super().__init__()
self.token_embedding = nn.Embedding(config.vocab_size, config.model_dims)
self.position_embedding = nn.Embedding(config.max_length, config.model_dims)
self.layers = [
CLIPEncoderLayer(config.model_dims, config.num_heads, config.hidden_act)
for i in range(config.num_layers)
]
self.final_layer_norm = nn.LayerNorm(config.model_dims)
def _get_mask(self, N, dtype):
indices = mx.arange(N)
mask = indices[:, None] < indices[None]
mask = mask.astype(dtype) * (-6e4 if dtype == mx.float16 else -1e9)
return mask
def sanitize(self, weights):
new_weights = {}
for key, w in weights.items():
# Remove prefixes
if key.startswith("text_model."):
key = key[11:]
if key.startswith("embeddings."):
key = key[11:]
if key.startswith("encoder."):
key = key[8:]
# Map attention layers
if "self_attn." in key:
key = key.replace("self_attn.", "attention.")
if "q_proj." in key:
key = key.replace("q_proj.", "query_proj.")
if "k_proj." in key:
key = key.replace("k_proj.", "key_proj.")
if "v_proj." in key:
key = key.replace("v_proj.", "value_proj.")
# Map ffn layers
if "mlp.fc1" in key:
key = key.replace("mlp.fc1", "linear1")
if "mlp.fc2" in key:
key = key.replace("mlp.fc2", "linear2")
new_weights[key] = w
return new_weights
def __call__(self, x):
# Extract some shapes
B, N = x.shape
eos_tokens = x.argmax(-1)
# Compute the embeddings
x = self.token_embedding(x)
x = x + self.position_embedding.weight[:N]
# Compute the features from the transformer
mask = self._get_mask(N, x.dtype)
hidden_states = []
for l in self.layers:
x = l(x, mask)
hidden_states.append(x)
# Apply the final layernorm and return
x = self.final_layer_norm(x)
last_hidden_state = x
# Select the EOS token
pooled_output = x[mx.arange(len(x)), eos_tokens]
return CLIPOutput(
pooled_output=pooled_output,
last_hidden_state=last_hidden_state,
hidden_states=hidden_states,
)

View File

@@ -1,75 +0,0 @@
import json
from pathlib import Path
from PIL import Image
class Dataset:
def __getitem__(self, index: int):
raise NotImplementedError()
def __len__(self):
raise NotImplementedError()
class LocalDataset(Dataset):
prompt_key = "prompt"
def __init__(self, dataset: str, data_file):
self.dataset_base = Path(dataset)
with open(data_file, "r") as fid:
self._data = [json.loads(l) for l in fid]
def __len__(self):
return len(self._data)
def __getitem__(self, index: int):
item = self._data[index]
image = Image.open(self.dataset_base / item["image"])
return image, item[self.prompt_key]
class LegacyDataset(LocalDataset):
prompt_key = "text"
def __init__(self, dataset: str):
self.dataset_base = Path(dataset)
with open(self.dataset_base / "index.json") as f:
self._data = json.load(f)["data"]
class HuggingFaceDataset(Dataset):
def __init__(self, dataset: str):
from datasets import load_dataset as hf_load_dataset
self._df = hf_load_dataset(dataset)["train"]
def __len__(self):
return len(self._df)
def __getitem__(self, index: int):
item = self._df[index]
return item["image"], item["prompt"]
def load_dataset(dataset: str):
dataset_base = Path(dataset)
data_file = dataset_base / "train.jsonl"
legacy_file = dataset_base / "index.json"
if data_file.exists():
print(f"Load the local dataset {data_file} .", flush=True)
dataset = LocalDataset(dataset, data_file)
elif legacy_file.exists():
print(f"Load the local dataset {legacy_file} .")
print()
print(" WARNING: 'index.json' is deprecated in favor of 'train.jsonl'.")
print(" See the README for details.")
print(flush=True)
dataset = LegacyDataset(dataset)
else:
print(f"Load the Hugging Face dataset {dataset} .", flush=True)
dataset = HuggingFaceDataset(dataset)
return dataset

View File

@@ -1,246 +0,0 @@
# Copyright © 2024 Apple Inc.
from typing import Tuple
import mlx.core as mx
import mlx.nn as nn
from mlx.utils import tree_unflatten
from tqdm import tqdm
from .lora import LoRALinear
from .sampler import FluxSampler
from .utils import (
load_ae,
load_clip,
load_clip_tokenizer,
load_flow_model,
load_t5,
load_t5_tokenizer,
)
class FluxPipeline:
def __init__(self, name: str, t5_padding: bool = True):
self.dtype = mx.bfloat16
self.name = name
self.t5_padding = t5_padding
self.ae = load_ae(name)
self.flow = load_flow_model(name)
self.clip = load_clip(name)
self.clip_tokenizer = load_clip_tokenizer(name)
self.t5 = load_t5(name)
self.t5_tokenizer = load_t5_tokenizer(name)
self.sampler = FluxSampler(name)
def ensure_models_are_loaded(self):
mx.eval(
self.ae.parameters(),
self.flow.parameters(),
self.clip.parameters(),
self.t5.parameters(),
)
def reload_text_encoders(self):
self.t5 = load_t5(self.name)
self.clip = load_clip(self.name)
def tokenize(self, text):
t5_tokens = self.t5_tokenizer.encode(text, pad=self.t5_padding)
clip_tokens = self.clip_tokenizer.encode(text)
return t5_tokens, clip_tokens
def _prepare_latent_images(self, x):
b, h, w, c = x.shape
# Pack the latent image to 2x2 patches
x = x.reshape(b, h // 2, 2, w // 2, 2, c)
x = x.transpose(0, 1, 3, 5, 2, 4).reshape(b, h * w // 4, c * 4)
# Create positions ids used to positionally encode each patch. Due to
# the way RoPE works, this results in an interesting positional
# encoding where parts of the feature are holding different positional
# information. Namely, the first part holds information independent of
# the spatial position (hence 0s), the 2nd part holds vertical spatial
# information and the last one horizontal.
i = mx.zeros((h // 2, w // 2), dtype=mx.int32)
j, k = mx.meshgrid(mx.arange(h // 2), mx.arange(w // 2), indexing="ij")
x_ids = mx.stack([i, j, k], axis=-1)
x_ids = mx.repeat(x_ids.reshape(1, h * w // 4, 3), b, 0)
return x, x_ids
def _prepare_conditioning(self, n_images, t5_tokens, clip_tokens):
# Prepare the text features
txt = self.t5(t5_tokens)
if len(txt) == 1 and n_images > 1:
txt = mx.broadcast_to(txt, (n_images, *txt.shape[1:]))
txt_ids = mx.zeros((n_images, txt.shape[1], 3), dtype=mx.int32)
# Prepare the clip text features
vec = self.clip(clip_tokens).pooled_output
if len(vec) == 1 and n_images > 1:
vec = mx.broadcast_to(vec, (n_images, *vec.shape[1:]))
return txt, txt_ids, vec
def _denoising_loop(
self,
x_t,
x_ids,
txt,
txt_ids,
vec,
num_steps: int = 35,
guidance: float = 4.0,
start: float = 1,
stop: float = 0,
):
B = len(x_t)
def scalar(x):
return mx.full((B,), x, dtype=self.dtype)
guidance = scalar(guidance)
timesteps = self.sampler.timesteps(
num_steps,
x_t.shape[1],
start=start,
stop=stop,
)
for i in range(num_steps):
t = timesteps[i]
t_prev = timesteps[i + 1]
pred = self.flow(
img=x_t,
img_ids=x_ids,
txt=txt,
txt_ids=txt_ids,
y=vec,
timesteps=scalar(t),
guidance=guidance,
)
x_t = self.sampler.step(pred, x_t, t, t_prev)
yield x_t
def generate_latents(
self,
text: str,
n_images: int = 1,
num_steps: int = 35,
guidance: float = 4.0,
latent_size: Tuple[int, int] = (64, 64),
seed=None,
):
# Set the PRNG state
if seed is not None:
mx.random.seed(seed)
# Create the latent variables
x_T = self.sampler.sample_prior((n_images, *latent_size, 16), dtype=self.dtype)
x_T, x_ids = self._prepare_latent_images(x_T)
# Get the conditioning
t5_tokens, clip_tokens = self.tokenize(text)
txt, txt_ids, vec = self._prepare_conditioning(n_images, t5_tokens, clip_tokens)
# Yield the conditioning for controlled evaluation by the caller
yield (x_T, x_ids, txt, txt_ids, vec)
# Yield the latent sequences from the denoising loop
yield from self._denoising_loop(
x_T, x_ids, txt, txt_ids, vec, num_steps=num_steps, guidance=guidance
)
def decode(self, x, latent_size: Tuple[int, int] = (64, 64)):
h, w = latent_size
x = x.reshape(len(x), h // 2, w // 2, -1, 2, 2)
x = x.transpose(0, 1, 4, 2, 5, 3).reshape(len(x), h, w, -1)
x = self.ae.decode(x)
return mx.clip(x + 1, 0, 2) * 0.5
def generate_images(
self,
text: str,
n_images: int = 1,
num_steps: int = 35,
guidance: float = 4.0,
latent_size: Tuple[int, int] = (64, 64),
seed=None,
reload_text_encoders: bool = True,
progress: bool = True,
):
latents = self.generate_latents(
text, n_images, num_steps, guidance, latent_size, seed
)
mx.eval(next(latents))
if reload_text_encoders:
self.reload_text_encoders()
for x_t in tqdm(latents, total=num_steps, disable=not progress, leave=True):
mx.eval(x_t)
images = []
for i in tqdm(range(len(x_t)), disable=not progress, desc="generate images"):
images.append(self.decode(x_t[i : i + 1]))
mx.eval(images[-1])
images = mx.concatenate(images, axis=0)
mx.eval(images)
return images
def training_loss(
self,
x_0: mx.array,
t5_features: mx.array,
clip_features: mx.array,
guidance: mx.array,
):
# Get the text conditioning
txt = t5_features
txt_ids = mx.zeros(txt.shape[:-1] + (3,), dtype=mx.int32)
vec = clip_features
# Prepare the latent input
x_0, x_ids = self._prepare_latent_images(x_0)
# Forward process
t = self.sampler.random_timesteps(*x_0.shape[:2], dtype=self.dtype)
eps = mx.random.normal(x_0.shape, dtype=self.dtype)
x_t = self.sampler.add_noise(x_0, t, noise=eps)
x_t = mx.stop_gradient(x_t)
# Do the denoising
pred = self.flow(
img=x_t,
img_ids=x_ids,
txt=txt,
txt_ids=txt_ids,
y=vec,
timesteps=t,
guidance=guidance,
)
return (pred + x_0 - eps).square().mean()
def linear_to_lora_layers(self, rank: int = 8, num_blocks: int = -1):
"""Swap the linear layers in the transformer blocks with LoRA layers."""
all_blocks = self.flow.double_blocks + self.flow.single_blocks
all_blocks.reverse()
num_blocks = num_blocks if num_blocks > 0 else len(all_blocks)
for i, block in zip(range(num_blocks), all_blocks):
loras = []
for name, module in block.named_modules():
if isinstance(module, nn.Linear):
loras.append((name, LoRALinear.from_base(module, r=rank)))
block.update_modules(tree_unflatten(loras))
def fuse_lora_layers(self):
fused_layers = []
for name, module in self.flow.named_modules():
if isinstance(module, LoRALinear):
fused_layers.append((name, module.fuse()))
self.flow.update_modules(tree_unflatten(fused_layers))

View File

@@ -1,321 +0,0 @@
# Copyright © 2024 Apple Inc.
import math
from dataclasses import dataclass
from functools import partial
from typing import List, Optional, Tuple
import mlx.core as mx
import mlx.nn as nn
def _rope(pos: mx.array, dim: int, theta: float):
scale = mx.arange(0, dim, 2, dtype=mx.float32) / dim
omega = 1.0 / (theta**scale)
x = pos[..., None] * omega
cosx = mx.cos(x)
sinx = mx.sin(x)
pe = mx.stack([cosx, -sinx, sinx, cosx], axis=-1)
pe = pe.reshape(*pe.shape[:-1], 2, 2)
return pe
@partial(mx.compile, shapeless=True)
def _ab_plus_cd(a, b, c, d):
return a * b + c * d
def _apply_rope(x, pe):
s = x.shape
x = x.reshape(*s[:-1], -1, 1, 2)
x = _ab_plus_cd(x[..., 0], pe[..., 0], x[..., 1], pe[..., 1])
return x.reshape(s)
def _attention(q: mx.array, k: mx.array, v: mx.array, pe: mx.array):
B, H, L, D = q.shape
q = _apply_rope(q, pe)
k = _apply_rope(k, pe)
x = mx.fast.scaled_dot_product_attention(q, k, v, scale=D ** (-0.5))
return x.transpose(0, 2, 1, 3).reshape(B, L, -1)
def timestep_embedding(
t: mx.array, dim: int, max_period: int = 10000, time_factor: float = 1000.0
):
half = dim // 2
freqs = mx.arange(0, half, dtype=mx.float32) / half
freqs = freqs * (-math.log(max_period))
freqs = mx.exp(freqs)
x = (time_factor * t)[:, None] * freqs[None]
x = mx.concatenate([mx.cos(x), mx.sin(x)], axis=-1)
return x.astype(t.dtype)
class EmbedND(nn.Module):
def __init__(self, dim: int, theta: int, axes_dim: List[int]):
super().__init__()
self.dim = dim
self.theta = theta
self.axes_dim = axes_dim
def __call__(self, ids: mx.array):
n_axes = ids.shape[-1]
pe = mx.concatenate(
[_rope(ids[..., i], self.axes_dim[i], self.theta) for i in range(n_axes)],
axis=-3,
)
return pe[:, None]
class MLPEmbedder(nn.Module):
def __init__(self, in_dim: int, hidden_dim: int):
super().__init__()
self.in_layer = nn.Linear(in_dim, hidden_dim, bias=True)
self.out_layer = nn.Linear(hidden_dim, hidden_dim, bias=True)
def __call__(self, x: mx.array) -> mx.array:
return self.out_layer(nn.silu(self.in_layer(x)))
class QKNorm(nn.Module):
def __init__(self, dim: int):
super().__init__()
self.query_norm = nn.RMSNorm(dim)
self.key_norm = nn.RMSNorm(dim)
def __call__(self, q: mx.array, k: mx.array) -> tuple[mx.array, mx.array]:
return self.query_norm(q), self.key_norm(k)
class SelfAttention(nn.Module):
def __init__(self, dim: int, num_heads: int = 8, qkv_bias: bool = False):
super().__init__()
self.num_heads = num_heads
head_dim = dim // num_heads
self.qkv = nn.Linear(dim, dim * 3, bias=qkv_bias)
self.norm = QKNorm(head_dim)
self.proj = nn.Linear(dim, dim)
def __call__(self, x: mx.array, pe: mx.array) -> mx.array:
H = self.num_heads
B, L, _ = x.shape
qkv = self.qkv(x)
q, k, v = mx.split(qkv, 3, axis=-1)
q = q.reshape(B, L, H, -1).transpose(0, 2, 1, 3)
k = k.reshape(B, L, H, -1).transpose(0, 2, 1, 3)
v = v.reshape(B, L, H, -1).transpose(0, 2, 1, 3)
q, k = self.norm(q, k)
x = _attention(q, k, v, pe)
x = self.proj(x)
return x
@dataclass
class ModulationOut:
shift: mx.array
scale: mx.array
gate: mx.array
class Modulation(nn.Module):
def __init__(self, dim: int, double: bool):
super().__init__()
self.is_double = double
self.multiplier = 6 if double else 3
self.lin = nn.Linear(dim, self.multiplier * dim, bias=True)
def __call__(self, x: mx.array) -> Tuple[ModulationOut, Optional[ModulationOut]]:
x = self.lin(nn.silu(x))
xs = mx.split(x[:, None, :], self.multiplier, axis=-1)
mod1 = ModulationOut(*xs[:3])
mod2 = ModulationOut(*xs[3:]) if self.is_double else None
return mod1, mod2
class DoubleStreamBlock(nn.Module):
def __init__(
self, hidden_size: int, num_heads: int, mlp_ratio: float, qkv_bias: bool = False
):
super().__init__()
mlp_hidden_dim = int(hidden_size * mlp_ratio)
self.num_heads = num_heads
self.hidden_size = hidden_size
self.img_mod = Modulation(hidden_size, double=True)
self.img_norm1 = nn.LayerNorm(hidden_size, affine=False, eps=1e-6)
self.img_attn = SelfAttention(
dim=hidden_size, num_heads=num_heads, qkv_bias=qkv_bias
)
self.img_norm2 = nn.LayerNorm(hidden_size, affine=False, eps=1e-6)
self.img_mlp = nn.Sequential(
nn.Linear(hidden_size, mlp_hidden_dim, bias=True),
nn.GELU(approx="tanh"),
nn.Linear(mlp_hidden_dim, hidden_size, bias=True),
)
self.txt_mod = Modulation(hidden_size, double=True)
self.txt_norm1 = nn.LayerNorm(hidden_size, affine=False, eps=1e-6)
self.txt_attn = SelfAttention(
dim=hidden_size, num_heads=num_heads, qkv_bias=qkv_bias
)
self.txt_norm2 = nn.LayerNorm(hidden_size, affine=False, eps=1e-6)
self.txt_mlp = nn.Sequential(
nn.Linear(hidden_size, mlp_hidden_dim, bias=True),
nn.GELU(approx="tanh"),
nn.Linear(mlp_hidden_dim, hidden_size, bias=True),
)
self.sharding_group = None
def __call__(
self, img: mx.array, txt: mx.array, vec: mx.array, pe: mx.array
) -> Tuple[mx.array, mx.array]:
B, L, _ = img.shape
_, S, _ = txt.shape
H = self.num_heads
img_mod1, img_mod2 = self.img_mod(vec)
txt_mod1, txt_mod2 = self.txt_mod(vec)
# prepare image for attention
img_modulated = self.img_norm1(img)
img_modulated = (1 + img_mod1.scale) * img_modulated + img_mod1.shift
img_qkv = self.img_attn.qkv(img_modulated)
img_q, img_k, img_v = mx.split(img_qkv, 3, axis=-1)
img_q = img_q.reshape(B, L, H, -1).transpose(0, 2, 1, 3)
img_k = img_k.reshape(B, L, H, -1).transpose(0, 2, 1, 3)
img_v = img_v.reshape(B, L, H, -1).transpose(0, 2, 1, 3)
img_q, img_k = self.img_attn.norm(img_q, img_k)
# prepare txt for attention
txt_modulated = self.txt_norm1(txt)
txt_modulated = (1 + txt_mod1.scale) * txt_modulated + txt_mod1.shift
txt_qkv = self.txt_attn.qkv(txt_modulated)
txt_q, txt_k, txt_v = mx.split(txt_qkv, 3, axis=-1)
txt_q = txt_q.reshape(B, S, H, -1).transpose(0, 2, 1, 3)
txt_k = txt_k.reshape(B, S, H, -1).transpose(0, 2, 1, 3)
txt_v = txt_v.reshape(B, S, H, -1).transpose(0, 2, 1, 3)
txt_q, txt_k = self.txt_attn.norm(txt_q, txt_k)
# run actual attention
q = mx.concatenate([txt_q, img_q], axis=2)
k = mx.concatenate([txt_k, img_k], axis=2)
v = mx.concatenate([txt_v, img_v], axis=2)
attn = _attention(q, k, v, pe)
txt_attn, img_attn = mx.split(attn, [S], axis=1)
# Project - cat - average - split
txt_attn = self.txt_attn.proj(txt_attn)
img_attn = self.img_attn.proj(img_attn)
if self.sharding_group is not None:
attn = mx.concatenate([txt_attn, img_attn], axis=1)
attn = mx.distributed.all_sum(attn, group=self.sharding_group)
txt_attn, img_attn = mx.split(attn, [S], axis=1)
# calculate the img bloks
img = img + img_mod1.gate * img_attn
img_mlp = self.img_mlp(
(1 + img_mod2.scale) * self.img_norm2(img) + img_mod2.shift
)
# calculate the txt bloks
txt = txt + txt_mod1.gate * txt_attn
txt_mlp = self.txt_mlp(
(1 + txt_mod2.scale) * self.txt_norm2(txt) + txt_mod2.shift
)
if self.sharding_group is not None:
txt_img = mx.concatenate([txt_mlp, img_mlp], axis=1)
txt_img = mx.distributed.all_sum(txt_img, group=self.sharding_group)
txt_mlp, img_mlp = mx.split(txt_img, [S], axis=1)
# finalize the img/txt blocks
img = img + img_mod2.gate * img_mlp
txt = txt + txt_mod2.gate * txt_mlp
return img, txt
class SingleStreamBlock(nn.Module):
def __init__(
self,
hidden_size: int,
num_heads: int,
mlp_ratio: float = 4.0,
qk_scale: Optional[float] = None,
):
super().__init__()
self.hidden_dim = hidden_size
self.num_heads = num_heads
head_dim = hidden_size // num_heads
self.scale = qk_scale or head_dim**-0.5
self.mlp_hidden_dim = int(hidden_size * mlp_ratio)
# qkv and mlp_in
self.linear1 = nn.Linear(hidden_size, hidden_size * 3 + self.mlp_hidden_dim)
# proj and mlp_out
self.linear2 = nn.Linear(hidden_size + self.mlp_hidden_dim, hidden_size)
self.norm = QKNorm(head_dim)
self.hidden_size = hidden_size
self.pre_norm = nn.LayerNorm(hidden_size, affine=False, eps=1e-6)
self.mlp_act = nn.GELU(approx="tanh")
self.modulation = Modulation(hidden_size, double=False)
def __call__(self, x: mx.array, vec: mx.array, pe: mx.array):
B, L, _ = x.shape
H = self.num_heads
mod, _ = self.modulation(vec)
x_mod = (1 + mod.scale) * self.pre_norm(x) + mod.shift
q, k, v, mlp = mx.split(
self.linear1(x_mod),
[self.hidden_size, 2 * self.hidden_size, 3 * self.hidden_size],
axis=-1,
)
q = q.reshape(B, L, H, -1).transpose(0, 2, 1, 3)
k = k.reshape(B, L, H, -1).transpose(0, 2, 1, 3)
v = v.reshape(B, L, H, -1).transpose(0, 2, 1, 3)
q, k = self.norm(q, k)
# compute attention
y = _attention(q, k, v, pe)
# compute activation in mlp stream, cat again and run second linear layer
y = self.linear2(mx.concatenate([y, self.mlp_act(mlp)], axis=2))
return x + mod.gate * y
class LastLayer(nn.Module):
def __init__(self, hidden_size: int, patch_size: int, out_channels: int):
super().__init__()
self.norm_final = nn.LayerNorm(hidden_size, affine=False, eps=1e-6)
self.linear = nn.Linear(
hidden_size, patch_size * patch_size * out_channels, bias=True
)
self.adaLN_modulation = nn.Sequential(
nn.SiLU(), nn.Linear(hidden_size, 2 * hidden_size, bias=True)
)
def __call__(self, x: mx.array, vec: mx.array):
shift, scale = mx.split(self.adaLN_modulation(vec), 2, axis=1)
x = (1 + scale[:, None, :]) * self.norm_final(x) + shift[:, None, :]
x = self.linear(x)
return x

View File

@@ -1,178 +0,0 @@
# Copyright © 2024 Apple Inc.
from dataclasses import dataclass
from typing import Optional
import mlx.core as mx
import mlx.nn as nn
from mlx.nn.layers.distributed import shard_inplace, shard_linear
from .layers import (
DoubleStreamBlock,
EmbedND,
LastLayer,
MLPEmbedder,
SingleStreamBlock,
timestep_embedding,
)
@dataclass
class FluxParams:
in_channels: int
vec_in_dim: int
context_in_dim: int
hidden_size: int
mlp_ratio: float
num_heads: int
depth: int
depth_single_blocks: int
axes_dim: list[int]
theta: int
qkv_bias: bool
guidance_embed: bool
class Flux(nn.Module):
def __init__(self, params: FluxParams):
super().__init__()
self.params = params
self.in_channels = params.in_channels
self.out_channels = self.in_channels
if params.hidden_size % params.num_heads != 0:
raise ValueError(
f"Hidden size {params.hidden_size} must be divisible by num_heads {params.num_heads}"
)
pe_dim = params.hidden_size // params.num_heads
if sum(params.axes_dim) != pe_dim:
raise ValueError(
f"Got {params.axes_dim} but expected positional dim {pe_dim}"
)
self.hidden_size = params.hidden_size
self.num_heads = params.num_heads
self.pe_embedder = EmbedND(
dim=pe_dim, theta=params.theta, axes_dim=params.axes_dim
)
self.img_in = nn.Linear(self.in_channels, self.hidden_size, bias=True)
self.time_in = MLPEmbedder(in_dim=256, hidden_dim=self.hidden_size)
self.vector_in = MLPEmbedder(params.vec_in_dim, self.hidden_size)
self.guidance_in = (
MLPEmbedder(in_dim=256, hidden_dim=self.hidden_size)
if params.guidance_embed
else nn.Identity()
)
self.txt_in = nn.Linear(params.context_in_dim, self.hidden_size)
self.double_blocks = [
DoubleStreamBlock(
self.hidden_size,
self.num_heads,
mlp_ratio=params.mlp_ratio,
qkv_bias=params.qkv_bias,
)
for _ in range(params.depth)
]
self.single_blocks = [
SingleStreamBlock(
self.hidden_size, self.num_heads, mlp_ratio=params.mlp_ratio
)
for _ in range(params.depth_single_blocks)
]
self.final_layer = LastLayer(self.hidden_size, 1, self.out_channels)
def sanitize(self, weights):
new_weights = {}
for k, w in weights.items():
if k.startswith("model.diffusion_model."):
k = k[22:]
if k.endswith(".scale"):
k = k[:-6] + ".weight"
for seq in ["img_mlp", "txt_mlp", "adaLN_modulation"]:
if f".{seq}." in k:
k = k.replace(f".{seq}.", f".{seq}.layers.")
break
new_weights[k] = w
return new_weights
def shard(self, group: Optional[mx.distributed.Group] = None):
group = group or mx.distributed.init()
N = group.size()
if N == 1:
return
for block in self.double_blocks:
block.num_heads //= N
block.img_attn.num_heads //= N
block.txt_attn.num_heads //= N
block.sharding_group = group
block.img_attn.qkv = shard_linear(
block.img_attn.qkv, "all-to-sharded", segments=3, group=group
)
block.txt_attn.qkv = shard_linear(
block.txt_attn.qkv, "all-to-sharded", segments=3, group=group
)
shard_inplace(block.img_attn.proj, "sharded-to-all", group=group)
shard_inplace(block.txt_attn.proj, "sharded-to-all", group=group)
block.img_mlp.layers[0] = shard_linear(
block.img_mlp.layers[0], "all-to-sharded", group=group
)
block.txt_mlp.layers[0] = shard_linear(
block.txt_mlp.layers[0], "all-to-sharded", group=group
)
shard_inplace(block.img_mlp.layers[2], "sharded-to-all", group=group)
shard_inplace(block.txt_mlp.layers[2], "sharded-to-all", group=group)
for block in self.single_blocks:
block.num_heads //= N
block.hidden_size //= N
block.linear1 = shard_linear(
block.linear1,
"all-to-sharded",
segments=[1 / 7, 2 / 7, 3 / 7],
group=group,
)
block.linear2 = shard_linear(
block.linear2, "sharded-to-all", segments=[1 / 5], group=group
)
def __call__(
self,
img: mx.array,
img_ids: mx.array,
txt: mx.array,
txt_ids: mx.array,
timesteps: mx.array,
y: mx.array,
guidance: Optional[mx.array] = None,
) -> mx.array:
if img.ndim != 3 or txt.ndim != 3:
raise ValueError("Input img and txt tensors must have 3 dimensions.")
img = self.img_in(img)
vec = self.time_in(timestep_embedding(timesteps, 256))
if self.params.guidance_embed:
if guidance is None:
raise ValueError(
"Didn't get guidance strength for guidance distilled model."
)
vec = vec + self.guidance_in(timestep_embedding(guidance, 256))
vec = vec + self.vector_in(y)
txt = self.txt_in(txt)
ids = mx.concatenate([txt_ids, img_ids], axis=1)
pe = self.pe_embedder(ids).astype(img.dtype)
for block in self.double_blocks:
img, txt = block(img=img, txt=txt, vec=vec, pe=pe)
img = mx.concatenate([txt, img], axis=1)
for block in self.single_blocks:
img = block(img, vec=vec, pe=pe)
img = img[:, txt.shape[1] :, ...]
img = self.final_layer(img, vec)
return img

View File

@@ -1,57 +0,0 @@
# Copyright © 2024 Apple Inc.
import math
from functools import lru_cache
import mlx.core as mx
class FluxSampler:
def __init__(self, name: str, base_shift: float = 0.5, max_shift: float = 1.15):
self._base_shift = base_shift
self._max_shift = max_shift
self._schnell = "schnell" in name
def _time_shift(self, x, t):
x1, x2 = 256, 4096
t1, t2 = self._base_shift, self._max_shift
exp_mu = math.exp((x - x1) * (t2 - t1) / (x2 - x1) + t1)
t = exp_mu / (exp_mu + (1 / t - 1))
return t
@lru_cache
def timesteps(
self, num_steps, image_sequence_length, start: float = 1, stop: float = 0
):
t = mx.linspace(start, stop, num_steps + 1)
if not self._schnell:
t = self._time_shift(image_sequence_length, t)
return t.tolist()
def random_timesteps(self, B, L, dtype=mx.float32, key=None):
if self._schnell:
# TODO: Should we upweigh 1 and 0.75?
t = mx.random.randint(1, 5, shape=(B,), key=key)
t = t.astype(dtype) / 4
else:
t = mx.random.uniform(shape=(B,), dtype=dtype, key=key)
t = self._time_shift(L, t)
return t
def sample_prior(self, shape, dtype=mx.float32, key=None):
return mx.random.normal(shape, dtype=dtype, key=key)
def add_noise(self, x, t, noise=None, key=None):
noise = (
noise
if noise is not None
else mx.random.normal(x.shape, dtype=x.dtype, key=key)
)
t = t.reshape([-1] + [1] * (x.ndim - 1))
return x * (1 - t) + t * noise
def step(self, pred, x_t, t, t_prev):
return x_t + (t_prev - t) * pred

View File

@@ -1,244 +0,0 @@
# Copyright © 2024 Apple Inc.
import math
from dataclasses import dataclass
from typing import List, Optional, Tuple
import mlx.core as mx
import mlx.nn as nn
_SHARED_REPLACEMENT_PATTERNS = [
(".block.", ".layers."),
(".k.", ".key_proj."),
(".o.", ".out_proj."),
(".q.", ".query_proj."),
(".v.", ".value_proj."),
("shared.", "wte."),
("lm_head.", "lm_head.linear."),
(".layer.0.layer_norm.", ".ln1."),
(".layer.1.layer_norm.", ".ln2."),
(".layer.2.layer_norm.", ".ln3."),
(".final_layer_norm.", ".ln."),
(
"layers.0.layer.0.SelfAttention.relative_attention_bias.",
"relative_attention_bias.embeddings.",
),
]
_ENCODER_REPLACEMENT_PATTERNS = [
(".layer.0.SelfAttention.", ".attention."),
(".layer.1.DenseReluDense.", ".dense."),
]
@dataclass
class T5Config:
vocab_size: int
num_layers: int
num_heads: int
relative_attention_num_buckets: int
d_kv: int
d_model: int
feed_forward_proj: str
tie_word_embeddings: bool
d_ff: Optional[int] = None
num_decoder_layers: Optional[int] = None
relative_attention_max_distance: int = 128
layer_norm_epsilon: float = 1e-6
@classmethod
def from_dict(cls, config):
return cls(
vocab_size=config["vocab_size"],
num_layers=config["num_layers"],
num_heads=config["num_heads"],
relative_attention_num_buckets=config["relative_attention_num_buckets"],
d_kv=config["d_kv"],
d_model=config["d_model"],
feed_forward_proj=config["feed_forward_proj"],
tie_word_embeddings=config["tie_word_embeddings"],
d_ff=config.get("d_ff", 4 * config["d_model"]),
num_decoder_layers=config.get("num_decoder_layers", config["num_layers"]),
relative_attention_max_distance=config.get(
"relative_attention_max_distance", 128
),
layer_norm_epsilon=config.get("layer_norm_epsilon", 1e-6),
)
class RelativePositionBias(nn.Module):
def __init__(self, config: T5Config, bidirectional: bool):
self.bidirectional = bidirectional
self.num_buckets = config.relative_attention_num_buckets
self.max_distance = config.relative_attention_max_distance
self.n_heads = config.num_heads
self.embeddings = nn.Embedding(self.num_buckets, self.n_heads)
@staticmethod
def _relative_position_bucket(rpos, bidirectional, num_buckets, max_distance):
num_buckets = num_buckets // 2 if bidirectional else num_buckets
max_exact = num_buckets // 2
abspos = rpos.abs()
is_small = abspos < max_exact
scale = (num_buckets - max_exact) / math.log(max_distance / max_exact)
buckets_large = (mx.log(abspos / max_exact) * scale).astype(mx.int16)
buckets_large = mx.minimum(max_exact + buckets_large, num_buckets - 1)
buckets = mx.where(is_small, abspos, buckets_large)
if bidirectional:
buckets = buckets + (rpos > 0) * num_buckets
else:
buckets = buckets * (rpos < 0)
return buckets
def __call__(self, query_length: int, key_length: int, offset: int = 0):
"""Compute binned relative position bias"""
context_position = mx.arange(offset, query_length)[:, None]
memory_position = mx.arange(key_length)[None, :]
# shape (query_length, key_length)
relative_position = memory_position - context_position
relative_position_bucket = self._relative_position_bucket(
relative_position,
bidirectional=self.bidirectional,
num_buckets=self.num_buckets,
max_distance=self.max_distance,
)
# shape (query_length, key_length, num_heads)
values = self.embeddings(relative_position_bucket)
# shape (num_heads, query_length, key_length)
return values.transpose(2, 0, 1)
class MultiHeadAttention(nn.Module):
def __init__(self, config: T5Config):
super().__init__()
inner_dim = config.d_kv * config.num_heads
self.num_heads = config.num_heads
self.query_proj = nn.Linear(config.d_model, inner_dim, bias=False)
self.key_proj = nn.Linear(config.d_model, inner_dim, bias=False)
self.value_proj = nn.Linear(config.d_model, inner_dim, bias=False)
self.out_proj = nn.Linear(inner_dim, config.d_model, bias=False)
def __call__(
self,
queries: mx.array,
keys: mx.array,
values: mx.array,
mask: Optional[mx.array],
cache: Optional[Tuple[mx.array, mx.array]] = None,
) -> [mx.array, Tuple[mx.array, mx.array]]:
queries = self.query_proj(queries)
keys = self.key_proj(keys)
values = self.value_proj(values)
num_heads = self.num_heads
B, L, _ = queries.shape
_, S, _ = keys.shape
queries = queries.reshape(B, L, num_heads, -1).transpose(0, 2, 1, 3)
keys = keys.reshape(B, S, num_heads, -1).transpose(0, 2, 1, 3)
values = values.reshape(B, S, num_heads, -1).transpose(0, 2, 1, 3)
if cache is not None:
key_cache, value_cache = cache
keys = mx.concatenate([key_cache, keys], axis=3)
values = mx.concatenate([value_cache, values], axis=2)
values_hat = mx.fast.scaled_dot_product_attention(
queries, keys, values, scale=1.0, mask=mask.astype(queries.dtype)
)
values_hat = values_hat.transpose(0, 2, 1, 3).reshape(B, L, -1)
return self.out_proj(values_hat), (keys, values)
class DenseActivation(nn.Module):
def __init__(self, config: T5Config):
super().__init__()
mlp_dims = config.d_ff or config.d_model * 4
self.gated = config.feed_forward_proj.startswith("gated")
if self.gated:
self.wi_0 = nn.Linear(config.d_model, mlp_dims, bias=False)
self.wi_1 = nn.Linear(config.d_model, mlp_dims, bias=False)
else:
self.wi = nn.Linear(config.d_model, mlp_dims, bias=False)
self.wo = nn.Linear(mlp_dims, config.d_model, bias=False)
activation = config.feed_forward_proj.removeprefix("gated-")
if activation == "relu":
self.act = nn.relu
elif activation == "gelu":
self.act = nn.gelu
elif activation == "silu":
self.act = nn.silu
else:
raise ValueError(f"Unknown activation: {activation}")
def __call__(self, x):
if self.gated:
hidden_act = self.act(self.wi_0(x))
hidden_linear = self.wi_1(x)
x = hidden_act * hidden_linear
else:
x = self.act(self.wi(x))
return self.wo(x)
class TransformerEncoderLayer(nn.Module):
def __init__(self, config: T5Config):
super().__init__()
self.attention = MultiHeadAttention(config)
self.ln1 = nn.RMSNorm(config.d_model, eps=config.layer_norm_epsilon)
self.ln2 = nn.RMSNorm(config.d_model, eps=config.layer_norm_epsilon)
self.dense = DenseActivation(config)
def __call__(self, x, mask):
y = self.ln1(x)
y, _ = self.attention(y, y, y, mask=mask)
x = x + y
y = self.ln2(x)
y = self.dense(y)
return x + y
class TransformerEncoder(nn.Module):
def __init__(self, config: T5Config):
super().__init__()
self.layers = [
TransformerEncoderLayer(config) for i in range(config.num_layers)
]
self.ln = nn.RMSNorm(config.d_model, eps=config.layer_norm_epsilon)
self.relative_attention_bias = RelativePositionBias(config, bidirectional=True)
def __call__(self, x: mx.array):
pos_bias = self.relative_attention_bias(x.shape[1], x.shape[1])
pos_bias = pos_bias.astype(x.dtype)
for layer in self.layers:
x = layer(x, mask=pos_bias)
return self.ln(x)
class T5Encoder(nn.Module):
def __init__(self, config: T5Config):
self.wte = nn.Embedding(config.vocab_size, config.d_model)
self.encoder = TransformerEncoder(config)
def sanitize(self, weights):
new_weights = {}
for k, w in weights.items():
for old, new in _SHARED_REPLACEMENT_PATTERNS:
k = k.replace(old, new)
if k.startswith("encoder."):
for old, new in _ENCODER_REPLACEMENT_PATTERNS:
k = k.replace(old, new)
new_weights[k] = w
return new_weights
def __call__(self, inputs: mx.array):
return self.encoder(self.wte(inputs))

View File

@@ -1,185 +0,0 @@
# Copyright © 2024 Apple Inc.
import mlx.core as mx
import regex
from sentencepiece import SentencePieceProcessor
class CLIPTokenizer:
"""A simple port of CLIPTokenizer from https://github.com/huggingface/transformers/ ."""
def __init__(self, bpe_ranks, vocab, max_length=77):
self.max_length = max_length
self.bpe_ranks = bpe_ranks
self.vocab = vocab
self.pat = regex.compile(
r"""<\|startoftext\|>|<\|endoftext\|>|'s|'t|'re|'ve|'m|'ll|'d|[\p{L}]+|[\p{N}]|[^\s\p{L}\p{N}]+""",
regex.IGNORECASE,
)
self._cache = {self.bos: self.bos, self.eos: self.eos}
@property
def bos(self):
return "<|startoftext|>"
@property
def bos_token(self):
return self.vocab[self.bos]
@property
def eos(self):
return "<|endoftext|>"
@property
def eos_token(self):
return self.vocab[self.eos]
def bpe(self, text):
if text in self._cache:
return self._cache[text]
unigrams = list(text[:-1]) + [text[-1] + "</w>"]
unique_bigrams = set(zip(unigrams, unigrams[1:]))
if not unique_bigrams:
return unigrams
# In every iteration try to merge the two most likely bigrams. If none
# was merged we are done.
#
# Ported from https://github.com/huggingface/transformers/blob/main/src/transformers/models/clip/tokenization_clip.py
while unique_bigrams:
bigram = min(
unique_bigrams, key=lambda pair: self.bpe_ranks.get(pair, float("inf"))
)
if bigram not in self.bpe_ranks:
break
new_unigrams = []
skip = False
for a, b in zip(unigrams, unigrams[1:]):
if skip:
skip = False
continue
if (a, b) == bigram:
new_unigrams.append(a + b)
skip = True
else:
new_unigrams.append(a)
if not skip:
new_unigrams.append(b)
unigrams = new_unigrams
unique_bigrams = set(zip(unigrams, unigrams[1:]))
self._cache[text] = unigrams
return unigrams
def tokenize(self, text, prepend_bos=True, append_eos=True):
if isinstance(text, list):
return [self.tokenize(t, prepend_bos, append_eos) for t in text]
# Lower case cleanup and split according to self.pat. Hugging Face does
# a much more thorough job here but this should suffice for 95% of
# cases.
clean_text = regex.sub(r"\s+", " ", text.lower())
tokens = regex.findall(self.pat, clean_text)
# Split the tokens according to the byte-pair merge file
bpe_tokens = [ti for t in tokens for ti in self.bpe(t)]
# Map to token ids and return
tokens = [self.vocab[t] for t in bpe_tokens]
if prepend_bos:
tokens = [self.bos_token] + tokens
if append_eos:
tokens.append(self.eos_token)
if len(tokens) > self.max_length:
tokens = tokens[: self.max_length]
if append_eos:
tokens[-1] = self.eos_token
return tokens
def encode(self, text):
if not isinstance(text, list):
return self.encode([text])
tokens = self.tokenize(text)
length = max(len(t) for t in tokens)
for t in tokens:
t.extend([self.eos_token] * (length - len(t)))
return mx.array(tokens)
class T5Tokenizer:
def __init__(self, model_file, max_length=512):
self._tokenizer = SentencePieceProcessor(model_file)
self.max_length = max_length
@property
def pad(self):
try:
return self._tokenizer.id_to_piece(self.pad_token)
except IndexError:
return None
@property
def pad_token(self):
return self._tokenizer.pad_id()
@property
def bos(self):
try:
return self._tokenizer.id_to_piece(self.bos_token)
except IndexError:
return None
@property
def bos_token(self):
return self._tokenizer.bos_id()
@property
def eos(self):
try:
return self._tokenizer.id_to_piece(self.eos_token)
except IndexError:
return None
@property
def eos_token(self):
return self._tokenizer.eos_id()
def tokenize(self, text, prepend_bos=True, append_eos=True, pad=True):
if isinstance(text, list):
return [self.tokenize(t, prepend_bos, append_eos, pad) for t in text]
tokens = self._tokenizer.encode(text)
if prepend_bos and self.bos_token >= 0:
tokens = [self.bos_token] + tokens
if append_eos and self.eos_token >= 0:
tokens.append(self.eos_token)
if pad and len(tokens) < self.max_length and self.pad_token >= 0:
tokens += [self.pad_token] * (self.max_length - len(tokens))
return tokens
def encode(self, text, pad=True):
if not isinstance(text, list):
return self.encode([text], pad=pad)
pad_token = self.pad_token if self.pad_token >= 0 else 0
tokens = self.tokenize(text, pad=pad)
length = max(len(t) for t in tokens)
for t in tokens:
t.extend([pad_token] * (length - len(t)))
return mx.array(tokens)

View File

@@ -1,98 +0,0 @@
import mlx.core as mx
import numpy as np
from PIL import Image, ImageFile
from tqdm import tqdm
from .datasets import Dataset
from .flux import FluxPipeline
class Trainer:
def __init__(self, flux: FluxPipeline, dataset: Dataset, args):
self.flux = flux
self.dataset = dataset
self.args = args
self.latents = []
self.t5_features = []
self.clip_features = []
def _random_crop_resize(self, img):
resolution = self.args.resolution
width, height = img.size
a, b, c, d = mx.random.uniform(shape=(4,), stream=mx.cpu).tolist()
# Random crop the input image between 0.8 to 1.0 of its original dimensions
crop_size = (
max((0.8 + 0.2 * a) * width, resolution[0]),
max((0.8 + 0.2 * b) * height, resolution[1]),
)
pan = (width - crop_size[0], height - crop_size[1])
img = img.crop(
(
pan[0] * c,
pan[1] * d,
crop_size[0] + pan[0] * c,
crop_size[1] + pan[1] * d,
)
)
# Fit the largest rectangle with the ratio of resolution in the image
# rectangle.
width, height = crop_size
ratio = resolution[0] / resolution[1]
r1 = (height * ratio, height)
r2 = (width, width / ratio)
r = r1 if r1[0] <= width else r2
img = img.crop(
(
(width - r[0]) / 2,
(height - r[1]) / 2,
(width + r[0]) / 2,
(height + r[1]) / 2,
)
)
# Finally resize the image to resolution
img = img.resize(resolution, Image.LANCZOS)
return mx.array(np.array(img))
def _encode_image(self, input_img: ImageFile.ImageFile, num_augmentations: int):
for i in range(num_augmentations):
img = self._random_crop_resize(input_img)
img = (img[:, :, :3].astype(self.flux.dtype) / 255) * 2 - 1
x_0 = self.flux.ae.encode(img[None])
x_0 = x_0.astype(self.flux.dtype)
mx.eval(x_0)
self.latents.append(x_0)
def _encode_prompt(self, prompt):
t5_tok, clip_tok = self.flux.tokenize([prompt])
t5_feat = self.flux.t5(t5_tok)
clip_feat = self.flux.clip(clip_tok).pooled_output
mx.eval(t5_feat, clip_feat)
self.t5_features.append(t5_feat)
self.clip_features.append(clip_feat)
def encode_dataset(self):
"""Encode the images & prompt in the latent space to prepare for training."""
self.flux.ae.eval()
for image, prompt in tqdm(self.dataset, desc="encode dataset"):
self._encode_image(image, self.args.num_augmentations)
self._encode_prompt(prompt)
def iterate(self, batch_size):
xs = mx.concatenate(self.latents)
t5 = mx.concatenate(self.t5_features)
clip = mx.concatenate(self.clip_features)
mx.eval(xs, t5, clip)
n_aug = self.args.num_augmentations
while True:
x_indices = mx.random.permutation(len(self.latents))
c_indices = x_indices // n_aug
for i in range(0, len(self.latents), batch_size):
x_i = x_indices[i : i + batch_size]
c_i = c_indices[i : i + batch_size]
yield xs[x_i], t5[c_i], clip[c_i]

View File

@@ -1,230 +0,0 @@
# Copyright © 2024 Apple Inc.
import json
import os
from dataclasses import dataclass
from pathlib import Path
from typing import Optional, Union
import mlx.core as mx
from huggingface_hub import hf_hub_download
from .autoencoder import AutoEncoder, AutoEncoderParams
from .clip import CLIPTextModel, CLIPTextModelConfig
from .model import Flux, FluxParams
from .t5 import T5Config, T5Encoder
from .tokenizers import CLIPTokenizer, T5Tokenizer
@dataclass
class ModelSpec:
params: FluxParams
ae_params: AutoEncoderParams
ckpt_path: Optional[str]
ae_path: Optional[str]
repo_id: Optional[str]
repo_flow: Optional[str]
repo_ae: Optional[str]
configs = {
"flux-dev": ModelSpec(
repo_id="black-forest-labs/FLUX.1-dev",
repo_flow="flux1-dev.safetensors",
repo_ae="ae.safetensors",
ckpt_path=os.getenv("FLUX_DEV"),
params=FluxParams(
in_channels=64,
vec_in_dim=768,
context_in_dim=4096,
hidden_size=3072,
mlp_ratio=4.0,
num_heads=24,
depth=19,
depth_single_blocks=38,
axes_dim=[16, 56, 56],
theta=10_000,
qkv_bias=True,
guidance_embed=True,
),
ae_path=os.getenv("AE"),
ae_params=AutoEncoderParams(
resolution=256,
in_channels=3,
ch=128,
out_ch=3,
ch_mult=[1, 2, 4, 4],
num_res_blocks=2,
z_channels=16,
scale_factor=0.3611,
shift_factor=0.1159,
),
),
"flux-schnell": ModelSpec(
repo_id="black-forest-labs/FLUX.1-schnell",
repo_flow="flux1-schnell.safetensors",
repo_ae="ae.safetensors",
ckpt_path=os.getenv("FLUX_SCHNELL"),
params=FluxParams(
in_channels=64,
vec_in_dim=768,
context_in_dim=4096,
hidden_size=3072,
mlp_ratio=4.0,
num_heads=24,
depth=19,
depth_single_blocks=38,
axes_dim=[16, 56, 56],
theta=10_000,
qkv_bias=True,
guidance_embed=False,
),
ae_path=os.getenv("AE"),
ae_params=AutoEncoderParams(
resolution=256,
in_channels=3,
ch=128,
out_ch=3,
ch_mult=[1, 2, 4, 4],
num_res_blocks=2,
z_channels=16,
scale_factor=0.3611,
shift_factor=0.1159,
),
),
}
def load_flow_model(name: str, hf_download: bool = True):
# Get the safetensors file to load
ckpt_path = configs[name].ckpt_path
# Download if needed
if (
ckpt_path is None
and configs[name].repo_id is not None
and configs[name].repo_flow is not None
and hf_download
):
ckpt_path = hf_hub_download(configs[name].repo_id, configs[name].repo_flow)
# Make the model
model = Flux(configs[name].params)
# Load the checkpoint if needed
if ckpt_path is not None:
weights = mx.load(ckpt_path)
weights = model.sanitize(weights)
model.load_weights(list(weights.items()))
return model
def load_ae(name: str, hf_download: bool = True):
# Get the safetensors file to load
ckpt_path = configs[name].ae_path
# Download if needed
if (
ckpt_path is None
and configs[name].repo_id is not None
and configs[name].repo_ae is not None
and hf_download
):
ckpt_path = hf_hub_download(configs[name].repo_id, configs[name].repo_ae)
# Make the autoencoder
ae = AutoEncoder(configs[name].ae_params)
# Load the checkpoint if needed
if ckpt_path is not None:
weights = mx.load(ckpt_path)
weights = ae.sanitize(weights)
ae.load_weights(list(weights.items()))
return ae
def load_clip(name: str):
# Load the config
config_path = hf_hub_download(configs[name].repo_id, "text_encoder/config.json")
with open(config_path) as f:
config = CLIPTextModelConfig.from_dict(json.load(f))
# Make the clip text encoder
clip = CLIPTextModel(config)
# Load the weights
ckpt_path = hf_hub_download(configs[name].repo_id, "text_encoder/model.safetensors")
weights = mx.load(ckpt_path)
weights = clip.sanitize(weights)
clip.load_weights(list(weights.items()))
return clip
def load_t5(name: str):
# Load the config
config_path = hf_hub_download(configs[name].repo_id, "text_encoder_2/config.json")
with open(config_path) as f:
config = T5Config.from_dict(json.load(f))
# Make the T5 model
t5 = T5Encoder(config)
# Load the weights
model_index = hf_hub_download(
configs[name].repo_id, "text_encoder_2/model.safetensors.index.json"
)
weight_files = set()
with open(model_index) as f:
for _, w in json.load(f)["weight_map"].items():
weight_files.add(w)
weights = {}
for w in weight_files:
w = f"text_encoder_2/{w}"
w = hf_hub_download(configs[name].repo_id, w)
weights.update(mx.load(w))
weights = t5.sanitize(weights)
t5.load_weights(list(weights.items()))
return t5
def load_clip_tokenizer(name: str):
vocab_file = hf_hub_download(configs[name].repo_id, "tokenizer/vocab.json")
with open(vocab_file, encoding="utf-8") as f:
vocab = json.load(f)
merges_file = hf_hub_download(configs[name].repo_id, "tokenizer/merges.txt")
with open(merges_file, encoding="utf-8") as f:
bpe_merges = f.read().strip().split("\n")[1 : 49152 - 256 - 2 + 1]
bpe_merges = [tuple(m.split()) for m in bpe_merges]
bpe_ranks = dict(map(reversed, enumerate(bpe_merges)))
return CLIPTokenizer(bpe_ranks, vocab, max_length=77)
def load_t5_tokenizer(name: str, pad: bool = True):
model_file = hf_hub_download(configs[name].repo_id, "tokenizer_2/spiece.model")
return T5Tokenizer(model_file, 256 if "schnell" in name else 512)
def save_config(
config: dict,
config_path: Union[str, Path],
) -> None:
"""Save the model configuration to the ``config_path``.
The final configuration will be sorted before saving for better readability.
Args:
config (dict): The model configuration.
config_path (Union[str, Path]): Model configuration file path.
"""
# Sort the config for better readability
config = dict(sorted(config.items()))
# Write the config to the provided file
with open(config_path, "w") as fid:
json.dump(config, fid, indent=4)

View File

@@ -1,109 +0,0 @@
import argparse
import mlx.core as mx
import mlx.nn as nn
import numpy as np
from PIL import Image
from tqdm import tqdm
from flux import FluxPipeline
def print_zero(group, *args, **kwargs):
if group.rank() == 0:
flush = kwargs.pop("flush", True)
print(*args, **kwargs, flush=flush)
def quantization_predicate(name, m):
return hasattr(m, "to_quantized") and m.weight.shape[1] % 512 == 0
def to_latent_size(image_size):
h, w = image_size
h = ((h + 15) // 16) * 16
w = ((w + 15) // 16) * 16
if (h, w) != image_size:
print(
"Warning: The image dimensions need to be divisible by 16px. "
f"Changing size to {h}x{w}."
)
return (h // 8, w // 8)
if __name__ == "__main__":
parser = argparse.ArgumentParser(
description="Generate images from a textual prompt using FLUX"
)
parser.add_argument("--quantize", "-q", action="store_true")
parser.add_argument("--model", choices=["schnell", "dev"], default="schnell")
parser.add_argument("--output", default="out.png")
args = parser.parse_args()
flux = FluxPipeline("flux-" + args.model, t5_padding=True)
if args.quantize:
nn.quantize(flux.flow, class_predicate=quantization_predicate)
nn.quantize(flux.t5, class_predicate=quantization_predicate)
nn.quantize(flux.clip, class_predicate=quantization_predicate)
group = mx.distributed.init()
if group.size() > 1:
flux.flow.shard(group)
print_zero(group, "Loading models")
flux.ensure_models_are_loaded()
def print_help():
print_zero(group, "The command list:")
print_zero(group, "- 'q' to exit")
print_zero(group, "- 's HxW' to change the size of the image")
print_zero(group, "- 'n S' to change the number of steps")
print_zero(group, "- 'h' to print this help")
print_zero(group, "FLUX interactive session")
print_help()
seed = 0
size = (512, 512)
latent_size = to_latent_size(size)
steps = 50 if args.model == "dev" else 4
while True:
prompt = input(">> " if group.rank() == 0 else "")
if prompt == "q":
break
if prompt == "h":
print_help()
continue
if prompt.startswith("s "):
size = tuple([int(xi) for xi in prompt[2:].split("x")])
print_zero(group, "Setting the size to", size)
latent_size = to_latent_size(size)
continue
if prompt.startswith("n "):
steps = int(prompt[2:])
print_zero(group, "Setting the steps to", steps)
continue
seed += 1
latents = flux.generate_latents(
prompt,
n_images=1,
num_steps=steps,
latent_size=latent_size,
guidance=4.0,
seed=seed,
)
print_zero(group, "Processing prompt")
mx.eval(next(latents))
print_zero(group, "Generating latents")
for xt in tqdm(latents, total=steps, disable=group.rank() > 0):
mx.eval(xt)
print_zero(group, "Generating image")
xt = flux.decode(xt, latent_size)
xt = (xt * 255).astype(mx.uint8)
mx.eval(xt)
im = Image.fromarray(np.array(xt[0]))
im.save(args.output)
print_zero(group, "Saved at", args.output, end="\n\n")

View File

@@ -1,7 +0,0 @@
mlx>=0.18.1
huggingface-hub
regex
numpy
tqdm
Pillow
sentencepiece

Binary file not shown.

Before

Width:  |  Height:  |  Size: 754 KiB

Binary file not shown.

Before

Width:  |  Height:  |  Size: 423 KiB

Binary file not shown.

Before

Width:  |  Height:  |  Size: 434 KiB

Binary file not shown.

Before

Width:  |  Height:  |  Size: 153 KiB

View File

@@ -1,175 +0,0 @@
# Copyright © 2024 Apple Inc.
import argparse
import mlx.core as mx
import mlx.nn as nn
import numpy as np
from PIL import Image
from tqdm import tqdm
from flux import FluxPipeline
def to_latent_size(image_size):
h, w = image_size
h = ((h + 15) // 16) * 16
w = ((w + 15) // 16) * 16
if (h, w) != image_size:
print(
"Warning: The image dimensions need to be divisible by 16px. "
f"Changing size to {h}x{w}."
)
return (h // 8, w // 8)
def quantization_predicate(name, m):
return hasattr(m, "to_quantized") and m.weight.shape[1] % 512 == 0
def load_adapter(flux, adapter_file, fuse=False):
weights, lora_config = mx.load(adapter_file, return_metadata=True)
rank = int(lora_config["lora_rank"])
num_blocks = int(lora_config["lora_blocks"])
flux.linear_to_lora_layers(rank, num_blocks)
flux.flow.load_weights(list(weights.items()), strict=False)
if fuse:
flux.fuse_lora_layers()
if __name__ == "__main__":
parser = argparse.ArgumentParser(
description="Generate images from a textual prompt using FLUX"
)
parser.add_argument("prompt")
parser.add_argument("--model", choices=["schnell", "dev"], default="schnell")
parser.add_argument("--n-images", type=int, default=4)
parser.add_argument(
"--image-size", type=lambda x: tuple(map(int, x.split("x"))), default=(512, 512)
)
parser.add_argument("--steps", type=int)
parser.add_argument("--guidance", type=float, default=4.0)
parser.add_argument("--n-rows", type=int, default=1)
parser.add_argument("--decoding-batch-size", type=int, default=1)
parser.add_argument("--quantize", "-q", action="store_true")
parser.add_argument("--preload-models", action="store_true")
parser.add_argument("--output", default="out.png")
parser.add_argument("--save-raw", action="store_true")
parser.add_argument("--seed", type=int)
parser.add_argument("--verbose", "-v", action="store_true")
parser.add_argument("--adapter")
parser.add_argument("--fuse-adapter", action="store_true")
parser.add_argument("--no-t5-padding", dest="t5_padding", action="store_false")
parser.add_argument("--force-shard", action="store_true")
args = parser.parse_args()
# Load the models
flux = FluxPipeline("flux-" + args.model, t5_padding=args.t5_padding)
args.steps = args.steps or (50 if args.model == "dev" else 2)
if args.adapter:
load_adapter(flux, args.adapter, fuse=args.fuse_adapter)
if args.quantize:
nn.quantize(flux.flow, class_predicate=quantization_predicate)
nn.quantize(flux.t5, class_predicate=quantization_predicate)
nn.quantize(flux.clip, class_predicate=quantization_predicate)
# Figure out what kind of distributed generation we should do
group = mx.distributed.init()
n_images = args.n_images
should_gather = False
if group.size() > 1:
if args.force_shard or n_images < group.size() or n_images % group.size() != 0:
flux.flow.shard(group)
else:
n_images //= group.size()
should_gather = True
# If we are sharding we should have the same seed and if we are doing
# data parallel generation we should have different seeds
if args.seed is None:
args.seed = mx.distributed.all_sum(mx.random.randint(0, 2**20)).item()
if should_gather:
args.seed = args.seed + group.rank()
if args.preload_models:
flux.ensure_models_are_loaded()
# Make the generator
latent_size = to_latent_size(args.image_size)
latents = flux.generate_latents(
args.prompt,
n_images=n_images,
num_steps=args.steps,
latent_size=latent_size,
guidance=args.guidance,
seed=args.seed,
)
# First we get and eval the conditioning
conditioning = next(latents)
mx.eval(conditioning)
peak_mem_conditioning = mx.get_peak_memory() / 1024**3
mx.reset_peak_memory()
# The following is not necessary but it may help in memory constrained
# systems by reusing the memory kept by the text encoders.
del flux.t5
del flux.clip
# Actual denoising loop
for x_t in tqdm(latents, total=args.steps, disable=group.rank() > 0):
mx.eval(x_t)
# The following is not necessary but it may help in memory constrained
# systems by reusing the memory kept by the flow transformer.
del flux.flow
peak_mem_generation = mx.get_peak_memory() / 1024**3
mx.reset_peak_memory()
# Decode them into images
decoded = []
for i in tqdm(range(0, n_images, args.decoding_batch_size)):
decoded.append(flux.decode(x_t[i : i + args.decoding_batch_size], latent_size))
mx.eval(decoded[-1])
peak_mem_decoding = mx.get_peak_memory() / 1024**3
peak_mem_overall = max(
peak_mem_conditioning, peak_mem_generation, peak_mem_decoding
)
# Gather them if each node has different images
decoded = mx.concatenate(decoded, axis=0)
if should_gather:
decoded = mx.distributed.all_gather(decoded)
mx.eval(decoded)
if args.save_raw:
*name, suffix = args.output.split(".")
name = ".".join(name)
x = decoded
x = (x * 255).astype(mx.uint8)
for i in range(len(x)):
im = Image.fromarray(np.array(x[i]))
im.save(".".join([name, str(i), suffix]))
else:
# Arrange them on a grid
x = decoded
x = mx.pad(x, [(0, 0), (4, 4), (4, 4), (0, 0)])
B, H, W, C = x.shape
x = x.reshape(args.n_rows, B // args.n_rows, H, W, C).transpose(0, 2, 1, 3, 4)
x = x.reshape(args.n_rows * H, B // args.n_rows * W, C)
x = (x * 255).astype(mx.uint8)
# Save them to disc
im = Image.fromarray(np.array(x))
im.save(args.output)
# Report the peak memory used during generation
if args.verbose and group.rank() == 0:
print(f"Peak memory used for the text: {peak_mem_conditioning:.3f}GB")
print(f"Peak memory used for the generation: {peak_mem_generation:.3f}GB")
print(f"Peak memory used for the decoding: {peak_mem_decoding:.3f}GB")
print(f"Peak memory used overall: {peak_mem_overall:.3f}GB")

View File

@@ -79,10 +79,10 @@ def load_image(image_source):
def prepare_inputs(processor, image, prompt):
if isinstance(image, str):
image = load_image(image)
inputs = processor(image, prompt, return_tensors="np")
inputs = processor(prompt, image, return_tensors="np")
pixel_values = mx.array(inputs["pixel_values"])
input_ids = mx.array(inputs["input_ids"])
return pixel_values, input_ids
return input_ids, pixel_values
def load_model(model_path, tokenizer_config={}):
@@ -126,7 +126,8 @@ def main():
processor, model = load_model(args.model, tokenizer_config)
prompt = codecs.decode(args.prompt, "unicode_escape")
pixel_values, input_ids = prepare_inputs(processor, args.image, prompt)
input_ids, pixel_values = prepare_inputs(processor, args.image, prompt)
print(prompt)
generated_text = generate_text(

View File

@@ -68,10 +68,11 @@ class LlavaModel(nn.Module):
input_ids: Optional[mx.array] = None,
pixel_values: Optional[mx.array] = None,
):
if pixel_values is None:
return self.language_model(input_ids)
# Get the input embeddings from the language model
inputs_embeds = self.language_model.model.embed_tokens(input_ids)
if pixel_values is None:
return inputs_embeds
# Get the ouptut hidden states from the vision model
*_, hidden_states = self.vision_tower(
@@ -104,21 +105,31 @@ class LlavaModel(nn.Module):
self, image_features, inputs_embeds, input_ids
):
image_token_index = self.config.image_token_index
batch_size, num_image_patches, embed_dim = image_features.shape
num_images, num_image_patches, embed_dim = image_features.shape
# Positions of <image> tokens in input_ids, assuming batch size is 1
image_positions = mx.array(
np.where(input_ids[0] == image_token_index)[0], mx.uint32
)
image_positions = np.where(input_ids[0] == image_token_index)[0].tolist()
if len(image_positions) != num_image_patches:
if len(image_positions) != num_images:
raise ValueError(
f"The number of image tokens ({len(image_positions)}) does not "
f" match the number of image patches ({num_image_patches})."
f" match the number of image inputs ({num_images})."
)
inputs_embeds[0, image_positions] = image_features
return inputs_embeds
text_segments = []
start_idx = 0
for position in image_positions:
text_segments.append(inputs_embeds[:, start_idx:position])
start_idx = position + 1
image_embeddings = mx.split(image_features, image_features.shape[0])
final_embeddings = [v for p in zip(text_segments, image_embeddings) for v in p]
final_embeddings += [inputs_embeds[:, start_idx:]]
# Create a final embedding of shape
# (1, num_image_patches*num_images + sequence_len, embed_dim)
return mx.concatenate(final_embeddings, axis=1)
def __call__(self, input_ids: mx.array, pixel_values: mx.array, cache=None):
input_embddings = self.get_input_embeddings(input_ids, pixel_values)

47
llms/CONTRIBUTING.md Normal file
View File

@@ -0,0 +1,47 @@
# Contributing to MLX LM
Below are some tips to port LLMs available on Hugging Face to MLX.
Before starting checkout the [general contribution
guidelines](https://github.com/ml-explore/mlx-examples/blob/main/CONTRIBUTING.md).
Next, from this directory, do an editable install:
```shell
pip install -e .
```
Then check if the model has weights in the
[safetensors](https://huggingface.co/docs/safetensors/index) format. If not
[follow instructions](https://huggingface.co/spaces/safetensors/convert) to
convert it.
After that, add the model file to the
[`mlx_lm/models`](https://github.com/ml-explore/mlx-examples/tree/main/llms/mlx_lm/models)
directory. You can see other examples there. We recommend starting from a model
that is similar to the model you are porting.
Make sure the name of the new model file is the same as the `model_type` in the
`config.json`, for example
[starcoder2](https://huggingface.co/bigcode/starcoder2-7b/blob/main/config.json#L17).
To determine the model layer names, we suggest either:
- Refer to the Transformers implementation if you are familiar with the
codebase.
- Load the model weights and check the weight names which will tell you about
the model structure.
- Look at the names of the weights by inspecting `model.safetensors.index.json`
in the Hugging Face repo.
To add LoRA support edit
[`mlx_lm/tuner/utils.py`](https://github.com/ml-explore/mlx-examples/blob/main/llms/mlx_lm/tuner/utils.py#L27-L60)
Finally, add a test for the new modle type to the [model
tests](https://github.com/ml-explore/mlx-examples/blob/main/llms/tests/test_models.py).
From the `llms/` directory, you can run the tests with:
```shell
python -m unittest discover tests/
```

2
llms/MANIFEST.in Normal file
View File

@@ -0,0 +1,2 @@
include mlx_lm/requirements.txt
recursive-include mlx_lm/ *.py

View File

@@ -1,6 +1,169 @@
# MOVE NOTICE
## Generate Text with LLMs and MLX
The mlx-lm package has moved to a [new repo](https://github.com/ml-explore/mlx-lm).
The easiest way to get started is to install the `mlx-lm` package:
The package has been removed from the MLX Examples repo. Send new contributions
and issues to the MLX LM repo.
**With `pip`**:
```sh
pip install mlx-lm
```
**With `conda`**:
```sh
conda install -c conda-forge mlx-lm
```
The `mlx-lm` package also has:
- [LoRA and QLoRA fine-tuning](https://github.com/ml-explore/mlx-examples/blob/main/llms/mlx_lm/LORA.md)
- [Merging models](https://github.com/ml-explore/mlx-examples/blob/main/llms/mlx_lm/MERGE.md)
- [HTTP model serving](https://github.com/ml-explore/mlx-examples/blob/main/llms/mlx_lm/SERVER.md)
### Python API
You can use `mlx-lm` as a module:
```python
from mlx_lm import load, generate
model, tokenizer = load("mlx-community/Mistral-7B-Instruct-v0.3-4bit")
response = generate(model, tokenizer, prompt="hello", verbose=True)
```
To see a description of all the arguments you can do:
```
>>> help(generate)
```
The `mlx-lm` package also comes with functionality to quantize and optionally
upload models to the Hugging Face Hub.
You can convert models in the Python API with:
```python
from mlx_lm import convert
repo = "mistralai/Mistral-7B-Instruct-v0.3"
upload_repo = "mlx-community/My-Mistral-7B-Instruct-v0.3-4bit"
convert(repo, quantize=True, upload_repo=upload_repo)
```
This will generate a 4-bit quantized Mistral 7B and upload it to the repo
`mlx-community/My-Mistral-7B-Instruct-v0.3-4bit`. It will also save the
converted model in the path `mlx_model` by default.
To see a description of all the arguments you can do:
```
>>> help(convert)
```
#### Streaming
For streaming generation, use the `stream_generate` function. This returns a
generator object which streams the output text. For example,
```python
from mlx_lm import load, stream_generate
repo = "mlx-community/Mistral-7B-Instruct-v0.3-4bit"
model, tokenizer = load(repo)
prompt = "Write a story about Einstein"
for t in stream_generate(model, tokenizer, prompt, max_tokens=512):
print(t, end="", flush=True)
print()
```
### Command Line
You can also use `mlx-lm` from the command line with:
```
mlx_lm.generate --model mistralai/Mistral-7B-Instruct-v0.3 --prompt "hello"
```
This will download a Mistral 7B model from the Hugging Face Hub and generate
text using the given prompt.
For a full list of options run:
```
mlx_lm.generate --help
```
To quantize a model from the command line run:
```
mlx_lm.convert --hf-path mistralai/Mistral-7B-Instruct-v0.3 -q
```
For more options run:
```
mlx_lm.convert --help
```
You can upload new models to Hugging Face by specifying `--upload-repo` to
`convert`. For example, to upload a quantized Mistral-7B model to the
[MLX Hugging Face community](https://huggingface.co/mlx-community) you can do:
```
mlx_lm.convert \
--hf-path mistralai/Mistral-7B-Instruct-v0.3 \
-q \
--upload-repo mlx-community/my-4bit-mistral
```
### Supported Models
The example supports Hugging Face format Mistral, Llama, and Phi-2 style
models. If the model you want to run is not supported, file an
[issue](https://github.com/ml-explore/mlx-examples/issues/new) or better yet,
submit a pull request.
Here are a few examples of Hugging Face models that work with this example:
- [mistralai/Mistral-7B-v0.1](https://huggingface.co/mistralai/Mistral-7B-v0.1)
- [meta-llama/Llama-2-7b-hf](https://huggingface.co/meta-llama/Llama-2-7b-hf)
- [deepseek-ai/deepseek-coder-6.7b-instruct](https://huggingface.co/deepseek-ai/deepseek-coder-6.7b-instruct)
- [01-ai/Yi-6B-Chat](https://huggingface.co/01-ai/Yi-6B-Chat)
- [microsoft/phi-2](https://huggingface.co/microsoft/phi-2)
- [mistralai/Mixtral-8x7B-Instruct-v0.1](https://huggingface.co/mistralai/Mixtral-8x7B-Instruct-v0.1)
- [Qwen/Qwen-7B](https://huggingface.co/Qwen/Qwen-7B)
- [pfnet/plamo-13b](https://huggingface.co/pfnet/plamo-13b)
- [pfnet/plamo-13b-instruct](https://huggingface.co/pfnet/plamo-13b-instruct)
- [stabilityai/stablelm-2-zephyr-1_6b](https://huggingface.co/stabilityai/stablelm-2-zephyr-1_6b)
- [internlm/internlm2-7b](https://huggingface.co/internlm/internlm2-7b)
Most
[Mistral](https://huggingface.co/models?library=transformers,safetensors&other=mistral&sort=trending),
[Llama](https://huggingface.co/models?library=transformers,safetensors&other=llama&sort=trending),
[Phi-2](https://huggingface.co/models?library=transformers,safetensors&other=phi&sort=trending),
and
[Mixtral](https://huggingface.co/models?library=transformers,safetensors&other=mixtral&sort=trending)
style models should work out of the box.
For some models (such as `Qwen` and `plamo`) the tokenizer requires you to
enable the `trust_remote_code` option. You can do this by passing
`--trust-remote-code` in the command line. If you don't specify the flag
explicitly, you will be prompted to trust remote code in the terminal when
running the model.
For `Qwen` models you must also specify the `eos_token`. You can do this by
passing `--eos-token "<|endoftext|>"` in the command
line.
These options can also be set in the Python API. For example:
```python
model, tokenizer = load(
"qwen/Qwen-7B",
tokenizer_config={"eos_token": "<|endoftext|>", "trust_remote_code": True},
)
```

View File

@@ -40,7 +40,7 @@ def generate(
if len(tokens) == 0:
print("No tokens generated for this prompt")
return
prompt_tps = len(prompt) / prompt_time
prompt_tps = prompt.size / prompt_time
gen_tps = (len(tokens) - 1) / gen_time
print(f"Prompt: {prompt_tps:.3f} tokens-per-sec")
print(f"Generation: {gen_tps:.3f} tokens-per-sec")

View File

@@ -19,10 +19,10 @@ class ModelArgs:
rms_norm_eps: float
vocab_size: int
context_length: int
num_key_value_heads: Optional[int] = None
num_key_value_heads: int = None
rope_theta: float = 10000
rope_traditional: bool = False
model_type: Optional[str] = None
model_type: str = None
rope_scaling: Optional[Dict[str, Union[float, str]]] = None
def __post_init__(self):
@@ -54,7 +54,7 @@ class Attention(nn.Module):
dim = args.hidden_size
self.n_heads = n_heads = args.num_attention_heads
self.n_kv_heads = n_kv_heads = args.num_key_value_heads or n_heads
self.n_kv_heads = n_kv_heads = args.num_key_value_heads
self.repeats = n_heads // n_kv_heads
@@ -66,7 +66,7 @@ class Attention(nn.Module):
self.v_proj = nn.Linear(dim, n_kv_heads * head_dim, bias=False)
self.o_proj = nn.Linear(n_heads * head_dim, dim, bias=False)
rope_scale = (
1 / float(args.rope_scaling["factor"])
1 / args.rope_scaling["factor"]
if args.rope_scaling is not None and args.rope_scaling["type"] == "linear"
else 1
)
@@ -254,7 +254,7 @@ def translate_weight_names(name):
return name
def load(gguf_file: str, repo: Optional[str] = None):
def load(gguf_file: str, repo: str = None):
# If the gguf_file exists, try to load model from it.
# Otherwise try to download and cache from the HF repo
if not Path(gguf_file).exists():

View File

@@ -7,7 +7,6 @@ import glob
import json
import shutil
from pathlib import Path
from typing import Dict
import mlx.core as mx
import mlx.nn as nn
@@ -150,8 +149,7 @@ def quantize(weights, config, args):
def make_shards(weights: dict, max_file_size_gibibyte: int = 15):
max_file_size_bytes = max_file_size_gibibyte << 30
shards = []
shard: Dict[str, mx.array] = {}
shard_size = 0
shard, shard_size = {}, 0
for k, v in weights.items():
if shard_size + v.nbytes > max_file_size_bytes:
shards.append(shard)

View File

@@ -23,7 +23,7 @@ class ModelArgs:
n_kv_heads: int
norm_eps: float
vocab_size: int
moe: dict
moe: dict = None
class Attention(nn.Module):
@@ -91,6 +91,7 @@ class FeedForward(nn.Module):
class MOEFeedForward(nn.Module):
def __init__(self, args: ModelArgs):
super().__init__()
self.num_experts = args.moe["num_experts"]
self.num_experts_per_tok = args.moe["num_experts_per_tok"]
self.experts = [FeedForward(args) for _ in range(self.num_experts)]
@@ -114,6 +115,7 @@ class MOEFeedForward(nn.Module):
yt = (yt * st).sum(axis=-1)
y.append(yt[None, :])
y = mx.concatenate(y)
return y.reshape(orig_shape)

266
llms/mlx_lm/LORA.md Normal file
View File

@@ -0,0 +1,266 @@
# Fine-Tuning with LoRA or QLoRA
You can use use the `mlx-lm` package to fine-tune an LLM with low rank
adaptation (LoRA) for a target task.[^lora] The example also supports quantized
LoRA (QLoRA).[^qlora] LoRA fine-tuning works with the following model families:
- Mistral
- Llama
- Phi2
- Mixtral
- Qwen2
- Gemma
- OLMo
- MiniCPM
- InternLM2
## Contents
- [Run](#Run)
- [Fine-tune](#Fine-tune)
- [Evaluate](#Evaluate)
- [Generate](#Generate)
- [Fuse](#Fuse)
- [Data](#Data)
- [Memory Issues](#Memory-Issues)
## Run
The main command is `mlx_lm.lora`. To see a full list of command-line options run:
```shell
mlx_lm.lora --help
```
Note, in the following the `--model` argument can be any compatible Hugging
Face repo or a local path to a converted model.
You can also specify a YAML config with `-c`/`--config`. For more on the format see the
[example YAML](examples/lora_config.yaml). For example:
```shell
mlx_lm.lora --config /path/to/config.yaml
```
If command-line flags are also used, they will override the corresponding
values in the config.
### Fine-tune
To fine-tune a model use:
```shell
mlx_lm.lora \
--model <path_to_model> \
--train \
--data <path_to_data> \
--iters 600
```
The `--data` argument must specify a path to a `train.jsonl`, `valid.jsonl`
when using `--train` and a path to a `test.jsonl` when using `--test`. For more
details on the data format see the section on [Data](#Data).
For example, to fine-tune a Mistral 7B you can use `--model
mistralai/Mistral-7B-v0.1`.
If `--model` points to a quantized model, then the training will use QLoRA,
otherwise it will use regular LoRA.
By default, the adapter config and weights are saved in `adapters/`. You can
specify the output location with `--adapter-path`.
You can resume fine-tuning with an existing adapter with
`--resume-adapter-file <path_to_adapters.safetensors>`.
### Evaluate
To compute test set perplexity use:
```shell
mlx_lm.lora \
--model <path_to_model> \
--adapter-path <path_to_adapters> \
--data <path_to_data> \
--test
```
### Generate
For generation use `mlx_lm.generate`:
```shell
mlx_lm.generate \
--model <path_to_model> \
--adapter-path <path_to_adapters> \
--prompt "<your_model_prompt>"
```
## Fuse
You can generate a model fused with the low-rank adapters using the
`mlx_lm.fuse` command. This command also allows you to optionally:
- Upload the fused model to the Hugging Face Hub.
- Export the fused model to GGUF. Note GGUF support is limited to Mistral,
Mixtral, and Llama style models in fp16 precision.
To see supported options run:
```shell
mlx_lm.fuse --help
```
To generate the fused model run:
```shell
mlx_lm.fuse --model <path_to_model>
```
This will by default load the adapters from `adapters/`, and save the fused
model in the path `lora_fused_model/`. All of these are configurable.
To upload a fused model, supply the `--upload-repo` and `--hf-path` arguments
to `mlx_lm.fuse`. The latter is the repo name of the original model, which is
useful for the sake of attribution and model versioning.
For example, to fuse and upload a model derived from Mistral-7B-v0.1, run:
```shell
mlx_lm.fuse \
--model mistralai/Mistral-7B-v0.1 \
--upload-repo mlx-community/my-lora-mistral-7b \
--hf-path mistralai/Mistral-7B-v0.1
```
To export a fused model to GGUF, run:
```shell
mlx_lm.fuse \
--model mistralai/Mistral-7B-v0.1 \
--export-gguf
```
This will save the GGUF model in `lora_fused_model/ggml-model-f16.gguf`. You
can specify the file name with `--gguf-path`.
## Data
The LoRA command expects you to provide a dataset with `--data`. The MLX
Examples GitHub repo has an [example of the WikiSQL
data](https://github.com/ml-explore/mlx-examples/tree/main/lora/data) in the
correct format.
For fine-tuning (`--train`), the data loader expects a `train.jsonl` and a
`valid.jsonl` to be in the data directory. For evaluation (`--test`), the data
loader expects a `test.jsonl` in the data directory.
Currently, `*.jsonl` files support three data formats: `chat`,
`completions`, and `text`. Here are three examples of these formats:
`chat`:
```jsonl
{
"messages": [
{
"role": "system",
"content": "You are a helpful assistant."
},
{
"role": "user",
"content": "Hello."
},
{
"role": "assistant",
"content": "How can I assistant you today."
}
]
}
```
`completions`:
```jsonl
{
"prompt": "What is the capital of France?",
"completion": "Paris."
}
```
`text`:
```jsonl
{
"text": "This is an example for the model."
}
```
Note, the format is automatically determined by the dataset. Note also, keys in
each line not expected by the loader will be ignored.
For the `chat` and `completions` formats, Hugging Face [chat
templates](https://huggingface.co/blog/chat-templates) are used. This applies
the model's chat template by default. If the model does not have a chat
template, then Hugging Face will use a default. For example, the final text in
the `chat` example above with Hugging Face's default template becomes:
```text
<|im_start|>system
You are a helpful assistant.<|im_end|>
<|im_start|>user
Hello.<|im_end|>
<|im_start|>assistant
How can I assistant you today.<|im_end|>
```
If you are unsure of the format to use, the `chat` or `completions` are good to
start with. For custom requirements on the format of the dataset, use the
`text` format to assemble the content yourself.
## Memory Issues
Fine-tuning a large model with LoRA requires a machine with a decent amount
of memory. Here are some tips to reduce memory use should you need to do so:
1. Try quantization (QLoRA). You can use QLoRA by generating a quantized model
with `convert.py` and the `-q` flag. See the [Setup](#setup) section for
more details.
2. Try using a smaller batch size with `--batch-size`. The default is `4` so
setting this to `2` or `1` will reduce memory consumption. This may slow
things down a little, but will also reduce the memory use.
3. Reduce the number of layers to fine-tune with `--lora-layers`. The default
is `16`, so you can try `8` or `4`. This reduces the amount of memory
needed for back propagation. It may also reduce the quality of the
fine-tuned model if you are fine-tuning with a lot of data.
4. Longer examples require more memory. If it makes sense for your data, one thing
you can do is break your examples into smaller
sequences when making the `{train, valid, test}.jsonl` files.
5. Gradient checkpointing lets you trade-off memory use (less) for computation
(more) by recomputing instead of storing intermediate values needed by the
backward pass. You can use gradient checkpointing by passing the
`--grad-checkpoint` flag. Gradient checkpointing will be more helpful for
larger batch sizes or sequence lengths with smaller or quantized models.
For example, for a machine with 32 GB the following should run reasonably fast:
```
mlx_lm.lora \
--model mistralai/Mistral-7B-v0.1 \
--train \
--batch-size 1 \
--lora-layers 4 \
--data wikisql
```
The above command on an M1 Max with 32 GB runs at about 250
tokens-per-second, using the MLX Example
[`wikisql`](https://github.com/ml-explore/mlx-examples/tree/main/lora/data)
data set.
[^lora]: Refer to the [arXiv paper](https://arxiv.org/abs/2106.09685) for more details on LoRA.
[^qlora]: Refer to the paper [QLoRA: Efficient Finetuning of Quantized LLMs](https://arxiv.org/abs/2305.14314)

22
llms/mlx_lm/MANAGE.md Normal file
View File

@@ -0,0 +1,22 @@
# Managing Models
You can use `mlx-lm` to manage models downloaded locally in your machine. They
are stored in the Hugging Face cache.
Scan models:
```shell
mlx_lm.manage --scan
```
Specify a `--pattern` to get info on a single or specific set of models:
```shell
mlx_lm.manage --scan --pattern mlx-community/Mistral-7B-Instruct-v0.2-4bit
```
To delete a model (or multiple models):
```shell
mlx_lm.manage --delete --pattern mlx-community/Mistral-7B-Instruct-v0.2-4bit
```

50
llms/mlx_lm/MERGE.md Normal file
View File

@@ -0,0 +1,50 @@
# Model Merging
You can use `mlx-lm` to merge models and upload them to the Hugging
Face hub or save them locally for LoRA fine tuning.
The main command is `mlx_lm.merge`:
```shell
mlx_lm.merge --config config.yaml
```
The merged model will be saved by default in `mlx_merged_model`. To see a
full list of options run:
```shell
mlx_lm.merge --help
```
Here is an example `config.yaml`:
```yaml
models:
- OpenPipe/mistral-ft-optimized-1218
- mlabonne/NeuralHermes-2.5-Mistral-7B
method: slerp
parameters:
t:
- filter: self_attn
value: [0, 0.5, 0.3, 0.7, 1]
- filter: mlp
value: [1, 0.5, 0.7, 0.3, 0]
- value: 0.5
```
The `models` field is a list of Hugging Face repo ids. The first model in the
list is treated as the base model into which the remaining models are merged.
The `method` field is the merging method. Right now `slerp` is the only
supported method.
The `parameters` are the corresponding parameters for the given `method`.
Each parameter is a list with `filter` determining which layer the parameter
applies to and `value` determining the actual value used. The last item in
the list without a `filter` field is the default.
If `value` is a list, it specifies the start and end values for the
corresponding segment of blocks. In the example above, the models have 32
blocks. For blocks 1-8, the layers with `self_attn` in the name will use the
values `np.linspace(0, 0.5, 8)`, the same layers in the next 8 blocks (9-16)
will use `np.linspace(0.5, 0.3, 8)`, and so on.

10
llms/mlx_lm/README.md Normal file
View File

@@ -0,0 +1,10 @@
## Generate Text with MLX and :hugs: Hugging Face
This an example of large language model text generation that can pull models from
the Hugging Face Hub.
For more information on this example, see the [README](../README.md) in the
parent directory.
This package also supports fine tuning with LoRA or QLoRA. For more information
see the [LoRA documentation](LORA.md).

76
llms/mlx_lm/SERVER.md Normal file
View File

@@ -0,0 +1,76 @@
# HTTP Model Server
You use `mlx-lm` to make an HTTP API for generating text with any supported
model. The HTTP API is intended to be similar to the [OpenAI chat
API](https://platform.openai.com/docs/api-reference).
> [!NOTE]
> The MLX LM server is not recommended for production as it only implements
> basic security checks.
Start the server with:
```shell
mlx_lm.server --model <path_to_model_or_hf_repo>
```
For example:
```shell
mlx_lm.server --model mistralai/Mistral-7B-Instruct-v0.1
```
This will start a text generation server on port `8080` of the `localhost`
using Mistral 7B instruct. The model will be downloaded from the provided
Hugging Face repo if it is not already in the local cache.
To see a full list of options run:
```shell
mlx_lm.server --help
```
You can make a request to the model by running:
```shell
curl localhost:8080/v1/chat/completions \
-H "Content-Type: application/json" \
-d '{
"messages": [{"role": "user", "content": "Say this is a test!"}],
"temperature": 0.7
}'
```
### Request Fields
- `messages`: An array of message objects representing the conversation
history. Each message object should have a role (e.g. user, assistant) and
content (the message text).
- `role_mapping`: (Optional) A dictionary to customize the role prefixes in
the generated prompt. If not provided, the default mappings are used.
- `stop`: (Optional) An array of strings or a single string. Thesse are
sequences of tokens on which the generation should stop.
- `max_tokens`: (Optional) An integer specifying the maximum number of tokens
to generate. Defaults to `100`.
- `stream`: (Optional) A boolean indicating if the response should be
streamed. If true, responses are sent as they are generated. Defaults to
false.
- `temperature`: (Optional) A float specifying the sampling temperature.
Defaults to `1.0`.
- `top_p`: (Optional) A float specifying the nucleus sampling parameter.
Defaults to `1.0`.
- `repetition_penalty`: (Optional) Applies a penalty to repeated tokens.
Defaults to `1.0`.
- `repetition_context_size`: (Optional) The size of the context window for
applying repetition penalty. Defaults to `20`.
- `logit_bias`: (Optional) A dictionary mapping token IDs to their bias
values. Defaults to `None`.

37
llms/mlx_lm/UPLOAD.md Normal file
View File

@@ -0,0 +1,37 @@
### Packaging for PyPI
Install `build` and `twine`:
```
pip install --user --upgrade build
pip install --user --upgrade twine
```
Generate the source distribution and wheel:
```
python -m build
```
> [!warning]
> Use a test server first
#### Test Upload
Upload to test server:
```
python -m twine upload --repository testpypi dist/*
```
Install from test server and check that it works:
```
python -m pip install --index-url https://test.pypi.org/simple/ --no-deps mlx-lm
```
#### Upload
```
python -m twine upload dist/*
```

4
llms/mlx_lm/__init__.py Normal file
View File

@@ -0,0 +1,4 @@
# Copyright © 2023-2024 Apple Inc.
from .utils import convert, generate, load, stream_generate
from .version import __version__

62
llms/mlx_lm/convert.py Normal file
View File

@@ -0,0 +1,62 @@
# Copyright © 2023-2024 Apple Inc.
import argparse
from .utils import convert
def configure_parser() -> argparse.ArgumentParser:
"""
Configures and returns the argument parser for the script.
Returns:
argparse.ArgumentParser: Configured argument parser.
"""
parser = argparse.ArgumentParser(
description="Convert Hugging Face model to MLX format"
)
parser.add_argument("--hf-path", type=str, help="Path to the Hugging Face model.")
parser.add_argument(
"--mlx-path", type=str, default="mlx_model", help="Path to save the MLX model."
)
parser.add_argument(
"-q", "--quantize", help="Generate a quantized model.", action="store_true"
)
parser.add_argument(
"--q-group-size", help="Group size for quantization.", type=int, default=64
)
parser.add_argument(
"--q-bits", help="Bits per weight for quantization.", type=int, default=4
)
parser.add_argument(
"--dtype",
help="Type to save the parameters, ignored if -q is given.",
type=str,
choices=["float16", "bfloat16", "float32"],
default="float16",
)
parser.add_argument(
"--upload-repo",
help="The Hugging Face repo to upload the model to.",
type=str,
default=None,
)
parser.add_argument(
"-d",
"--dequantize",
help="Dequantize a quantized model.",
action="store_true",
default=False,
)
return parser
def main():
parser = configure_parser()
args = parser.parse_args()
convert(**vars(args))
if __name__ == "__main__":
main()

View File

@@ -0,0 +1,71 @@
# The path to the local model directory or Hugging Face repo.
model: "mlx_model"
# Whether or not to train (boolean)
train: true
# Directory with {train, valid, test}.jsonl files
data: "/path/to/training/data"
# The PRNG seed
seed: 0
# Number of layers to fine-tune
lora_layers: 16
# Minibatch size.
batch_size: 4
# Iterations to train for.
iters: 1000
# Number of validation batches, -1 uses the entire validation set.
val_batches: 25
# Adam learning rate.
learning_rate: 1e-5
# Number of training steps between loss reporting.
steps_per_report: 10
# Number of training steps between validations.
steps_per_eval: 200
# Load path to resume training with the given adapter weights.
resume_adapter_file: null
# Save/load path for the trained adapter weights.
adapter_path: "adapters"
# Save the model every N iterations.
save_every: 100
# Evaluate on the test set after training
test: false
# Number of test set batches, -1 uses the entire test set.
test_batches: 100
# Maximum sequence length.
max_seq_length: 2048
# Use gradient checkpointing to reduce memory use.
grad_checkpoint: false
# Use DoRA instead of LoRA.
use_dora: false
# LoRA parameters can only be specified in a config file
lora_parameters:
# The layer keys to apply LoRA to.
# These will be applied for the last lora_layers
keys: ["self_attn.q_proj", "self_attn.v_proj"]
rank: 8
scale: 20.0
dropout: 0.0
# Schedule can only be specified in a config file, uncomment to use.
#lr_schedule:
# name: cosine_decay
# warmup: 100 # 0 for no warmup
# warmup_init: 1e-7 # 0 if not specified
# arguments: [1e-5, 1000, 1e-7] # passed to scheduler

View File

@@ -0,0 +1,11 @@
models:
- OpenPipe/mistral-ft-optimized-1218
- mlabonne/NeuralHermes-2.5-Mistral-7B
method: slerp
parameters:
t:
- filter: self_attn
value: [0, 0.5, 0.3, 0.7, 1]
- filter: mlp
value: [1, 0.5, 0.7, 0.3, 0]
- value: 0.5

131
llms/mlx_lm/fuse.py Normal file
View File

@@ -0,0 +1,131 @@
import argparse
import glob
import shutil
from pathlib import Path
from mlx.utils import tree_flatten, tree_unflatten
from .gguf import convert_to_gguf
from .tuner.dora import DoRALinear
from .tuner.lora import LoRALinear, LoRASwitchLinear
from .tuner.utils import apply_lora_layers, dequantize
from .utils import (
fetch_from_hub,
get_model_path,
save_config,
save_weights,
upload_to_hub,
)
def parse_arguments() -> argparse.Namespace:
parser = argparse.ArgumentParser(
description="Fuse fine-tuned adapters into the base model."
)
parser.add_argument(
"--model",
default="mlx_model",
help="The path to the local model directory or Hugging Face repo.",
)
parser.add_argument(
"--save-path",
default="lora_fused_model",
help="The path to save the fused model.",
)
parser.add_argument(
"--adapter-path",
type=str,
default="adapters",
help="Path to the trained adapter weights and config.",
)
parser.add_argument(
"--hf-path",
type=str,
default=None,
help="Path to the original Hugging Face model. Required for upload if --model is a local directory.",
)
parser.add_argument(
"--upload-repo",
help="The Hugging Face repo to upload the model to.",
type=str,
default=None,
)
parser.add_argument(
"--de-quantize",
help="Generate a de-quantized model.",
action="store_true",
)
parser.add_argument(
"--export-gguf",
help="Export model weights in GGUF format.",
action="store_true",
)
parser.add_argument(
"--gguf-path",
help="Path to save the exported GGUF format model weights. Default is ggml-model-f16.gguf.",
default="ggml-model-f16.gguf",
type=str,
)
return parser.parse_args()
def main() -> None:
print("Loading pretrained model")
args = parse_arguments()
model_path = get_model_path(args.model)
model, config, tokenizer = fetch_from_hub(model_path)
model.freeze()
model = apply_lora_layers(model, args.adapter_path)
fused_linears = [
(n, m.to_linear())
for n, m in model.named_modules()
if isinstance(m, (LoRASwitchLinear, LoRALinear, DoRALinear))
]
model.update_modules(tree_unflatten(fused_linears))
if args.de_quantize:
print("De-quantizing model")
model = dequantize(model)
weights = dict(tree_flatten(model.parameters()))
save_path = Path(args.save_path)
save_weights(save_path, weights)
py_files = glob.glob(str(model_path / "*.py"))
for file in py_files:
shutil.copy(file, save_path)
tokenizer.save_pretrained(save_path)
if args.de_quantize:
config.pop("quantization", None)
save_config(config, config_path=save_path / "config.json")
if args.export_gguf:
model_type = config["model_type"]
if model_type not in ["llama", "mixtral", "mistral"]:
raise ValueError(
f"Model type {model_type} not supported for GGUF conversion."
)
convert_to_gguf(model_path, weights, config, str(save_path / args.gguf_path))
if args.upload_repo is not None:
hf_path = args.hf_path or (
args.model if not Path(args.model).exists() else None
)
if hf_path is None:
raise ValueError(
"Must provide original Hugging Face repo to upload local model."
)
upload_to_hub(args.save_path, args.upload_repo, hf_path)
if __name__ == "__main__":
main()

161
llms/mlx_lm/generate.py Normal file
View File

@@ -0,0 +1,161 @@
# Copyright © 2023-2024 Apple Inc.
import argparse
import mlx.core as mx
from .utils import generate, load
DEFAULT_MODEL_PATH = "mlx_model"
DEFAULT_PROMPT = "hello"
DEFAULT_MAX_TOKENS = 100
DEFAULT_TEMP = 0.6
DEFAULT_TOP_P = 1.0
DEFAULT_SEED = 0
def setup_arg_parser():
"""Set up and return the argument parser."""
parser = argparse.ArgumentParser(description="LLM inference script")
parser.add_argument(
"--model",
type=str,
default="mlx_model",
help="The path to the local model directory or Hugging Face repo.",
)
parser.add_argument(
"--adapter-path",
type=str,
help="Optional path for the trained adapter weights and config.",
)
parser.add_argument(
"--trust-remote-code",
action="store_true",
help="Enable trusting remote code for tokenizer",
)
parser.add_argument(
"--eos-token",
type=str,
default=None,
help="End of sequence token for tokenizer",
)
parser.add_argument(
"--prompt", default=DEFAULT_PROMPT, help="Message to be processed by the model"
)
parser.add_argument(
"--max-tokens",
"-m",
type=int,
default=DEFAULT_MAX_TOKENS,
help="Maximum number of tokens to generate",
)
parser.add_argument(
"--temp", type=float, default=DEFAULT_TEMP, help="Sampling temperature"
)
parser.add_argument(
"--top-p", type=float, default=DEFAULT_TOP_P, help="Sampling top-p"
)
parser.add_argument("--seed", type=int, default=DEFAULT_SEED, help="PRNG seed")
parser.add_argument(
"--ignore-chat-template",
action="store_true",
help="Use the raw prompt without the tokenizer's chat template.",
)
parser.add_argument(
"--use-default-chat-template",
action="store_true",
help="Use the default chat template",
)
parser.add_argument(
"--colorize",
action="store_true",
help="Colorize output based on T[0] probability",
)
parser.add_argument(
"--cache-limit-gb",
type=int,
default=None,
help="Set the MLX cache limit in GB",
required=False,
)
return parser
def colorprint(color, s):
color_codes = {
"black": 30,
"red": 31,
"green": 32,
"yellow": 33,
"blue": 34,
"magenta": 35,
"cyan": 36,
"white": 39,
}
ccode = color_codes.get(color, 30)
print(f"\033[1m\033[{ccode}m{s}\033[0m", end="", flush=True)
def colorprint_by_t0(s, t0):
if t0 > 0.95:
color = "white"
elif t0 > 0.70:
color = "green"
elif t0 > 0.30:
color = "yellow"
else:
color = "red"
colorprint(color, s)
def main():
parser = setup_arg_parser()
args = parser.parse_args()
mx.random.seed(args.seed)
if args.cache_limit_gb is not None:
mx.metal.set_cache_limit(args.cache_limit_gb * 1024 * 1024 * 1024)
# Building tokenizer_config
tokenizer_config = {"trust_remote_code": True if args.trust_remote_code else None}
if args.eos_token is not None:
tokenizer_config["eos_token"] = args.eos_token
model, tokenizer = load(
args.model,
adapter_path=args.adapter_path,
tokenizer_config=tokenizer_config,
)
if args.use_default_chat_template:
if tokenizer.chat_template is None:
tokenizer.chat_template = tokenizer.default_chat_template
if not args.ignore_chat_template and (
hasattr(tokenizer, "apply_chat_template")
and tokenizer.chat_template is not None
):
messages = [{"role": "user", "content": args.prompt}]
prompt = tokenizer.apply_chat_template(
messages, tokenize=False, add_generation_prompt=True
)
else:
prompt = args.prompt
formatter = colorprint_by_t0 if args.colorize else None
generate(
model,
tokenizer,
prompt,
args.max_tokens,
verbose=True,
formatter=formatter,
temp=args.temp,
top_p=args.top_p,
)
if __name__ == "__main__":
main()

313
llms/mlx_lm/gguf.py Normal file
View File

@@ -0,0 +1,313 @@
import re
from enum import IntEnum
from pathlib import Path
from typing import Iterable, Optional, Set, Tuple, Union
import mlx.core as mx
from transformers import AutoTokenizer
class TokenType(IntEnum):
NORMAL = 1
UNKNOWN = 2
CONTROL = 3
USER_DEFINED = 4
UNUSED = 5
BYTE = 6
class GGMLFileType(IntEnum):
GGML_TYPE_F16 = 1
# copied from https://github.com/ggerganov/llama.cpp/blob/master/convert.py#L455
class HfVocab:
def __init__(
self,
fname_tokenizer: Path,
fname_added_tokens: Optional[Union[Path, None]] = None,
) -> None:
self.tokenizer = AutoTokenizer.from_pretrained(
fname_tokenizer,
cache_dir=fname_tokenizer,
local_files_only=True,
)
self.added_tokens_list = []
self.added_tokens_dict = dict()
self.added_tokens_ids = set()
for tok, tokidx in sorted(
self.tokenizer.get_added_vocab().items(), key=lambda x: x[1]
):
if tokidx >= self.tokenizer.vocab_size:
self.added_tokens_list.append(tok)
self.added_tokens_dict[tok] = tokidx
self.added_tokens_ids.add(tokidx)
self.specials = {
tok: self.tokenizer.get_vocab()[tok]
for tok in self.tokenizer.all_special_tokens
}
self.special_ids = set(self.tokenizer.all_special_ids)
self.vocab_size_base = self.tokenizer.vocab_size
self.vocab_size = self.vocab_size_base + len(self.added_tokens_list)
self.fname_tokenizer = fname_tokenizer
self.fname_added_tokens = fname_added_tokens
def hf_tokens(self) -> Iterable[Tuple[bytes, float, TokenType]]:
reverse_vocab = {
id: encoded_tok for encoded_tok, id in self.tokenizer.get_vocab().items()
}
for token_id in range(self.vocab_size_base):
if token_id in self.added_tokens_ids:
continue
token_text = reverse_vocab[token_id].encode("utf-8")
yield token_text, self.get_token_score(token_id), self.get_token_type(
token_id, token_text, self.special_ids
)
def get_token_type(
self, token_id: int, token_text: bytes, special_ids: Set[int]
) -> TokenType:
if re.fullmatch(rb"<0x[0-9A-Fa-f]{2}>", token_text):
return TokenType.BYTE
return TokenType.CONTROL if token_id in special_ids else TokenType.NORMAL
def get_token_score(self, token_id: int) -> float:
return -1000.0
def added_tokens(self) -> Iterable[Tuple[bytes, float, TokenType]]:
for text in self.added_tokens_list:
if text in self.specials:
toktype = self.get_token_type(
self.specials[text], b"", self.special_ids
)
score = self.get_token_score(self.specials[text])
else:
toktype = TokenType.USER_DEFINED
score = -1000.0
yield text.encode("utf-8"), score, toktype
def has_newline_token(self):
return "<0x0A>" in self.tokenizer.vocab or "\n" in self.tokenizer.vocab
def all_tokens(self) -> Iterable[Tuple[bytes, float, TokenType]]:
yield from self.hf_tokens()
yield from self.added_tokens()
def __repr__(self) -> str:
return f"<HfVocab with {self.vocab_size_base} base tokens and {len(self.added_tokens_list)} added tokens>"
@staticmethod
def load(path: Path) -> "HfVocab":
added_tokens_path = path.parent / "added_tokens.json"
return HfVocab(path, added_tokens_path if added_tokens_path.exists() else None)
def translate_weight_names(name):
name = name.replace("model.layers.", "blk.")
# for mixtral gate
name = name.replace("block_sparse_moe.gate", "ffn_gate_inp")
# for mixtral experts ffns
pattern = r"block_sparse_moe\.experts\.(\d+)\.w1\.weight"
replacement = r"ffn_gate.\1.weight"
name = re.sub(pattern, replacement, name)
pattern = r"block_sparse_moe\.experts\.(\d+)\.w2\.weight"
replacement = r"ffn_down.\1.weight"
name = re.sub(pattern, replacement, name)
pattern = r"block_sparse_moe\.experts\.(\d+)\.w3\.weight"
replacement = r"ffn_up.\1.weight"
name = re.sub(pattern, replacement, name)
name = name.replace("mlp.gate_proj", "ffn_gate")
name = name.replace("mlp.down_proj", "ffn_down")
name = name.replace("mlp.up_proj", "ffn_up")
name = name.replace("self_attn.q_proj", "attn_q")
name = name.replace("self_attn.k_proj", "attn_k")
name = name.replace("self_attn.v_proj", "attn_v")
name = name.replace("self_attn.o_proj", "attn_output")
name = name.replace("input_layernorm", "attn_norm")
name = name.replace("post_attention_layernorm", "ffn_norm")
name = name.replace("model.embed_tokens", "token_embd")
name = name.replace("model.norm", "output_norm")
name = name.replace("lm_head", "output")
return name
def permute_weights(weights, n_head, n_head_kv=None):
if n_head_kv is not None and n_head != n_head_kv:
n_head = n_head_kv
reshaped = weights.reshape(
n_head, 2, weights.shape[0] // n_head // 2, *weights.shape[1:]
)
swapped = reshaped.swapaxes(1, 2)
final_shape = weights.shape
return swapped.reshape(final_shape)
def prepare_metadata(config, vocab):
metadata = {
"general.name": "llama",
"llama.context_length": (
mx.array(config["max_position_embeddings"], dtype=mx.uint32)
if config.get("max_position_embeddings") is not None
else None
),
"llama.embedding_length": (
mx.array(config["hidden_size"], dtype=mx.uint32)
if config.get("hidden_size") is not None
else None
),
"llama.block_count": (
mx.array(config["num_hidden_layers"], dtype=mx.uint32)
if config.get("num_hidden_layers") is not None
else None
),
"llama.feed_forward_length": (
mx.array(config["intermediate_size"], dtype=mx.uint32)
if config.get("intermediate_size") is not None
else None
),
"llama.rope.dimension_count": (
mx.array(
config["hidden_size"] // config["num_attention_heads"], dtype=mx.uint32
)
if config.get("hidden_size") is not None
and config.get("num_attention_heads") is not None
else None
),
"llama.attention.head_count": (
mx.array(config["num_attention_heads"], dtype=mx.uint32)
if config.get("num_attention_heads") is not None
else None
),
"llama.attention.head_count_kv": (
mx.array(
config.get("num_key_value_heads", config["num_attention_heads"]),
dtype=mx.uint32,
)
if config.get("num_attention_heads") is not None
else None
),
"llama.expert_count": (
mx.array(config.get("num_local_experts", None), dtype=mx.uint32)
if config.get("num_local_experts") is not None
else None
),
"llama.expert_used_count": (
mx.array(config.get("num_experts_per_tok", None), dtype=mx.uint32)
if config.get("num_experts_per_tok") is not None
else None
),
"llama.attention.layer_norm_rms_epsilon": (
mx.array(config.get("rms_norm_eps", 1e-05))
if config.get("rms_norm_eps") is not None
else None
),
"llama.rope.freq_base": (
mx.array(config.get("rope_theta", 10000), dtype=mx.float32)
if config.get("rope_theta") is not None
else None
),
}
rope_scaling = config.get("rope_scaling")
if rope_scaling is not None and (typ := rope_scaling.get("type")):
rope_factor = rope_scaling.get("factor")
f_rope_scale = rope_factor
if typ == "linear":
rope_scaling_type = "linear"
metadata["llama.rope.scaling.type"] = rope_scaling_type
metadata["llama.rope.scaling.factor"] = mx.array(f_rope_scale)
metadata["general.file_type"] = mx.array(
GGMLFileType.GGML_TYPE_F16.value,
dtype=mx.uint32,
)
metadata["general.quantization_version"] = mx.array(
GGMLFileType.GGML_TYPE_F16.value,
dtype=mx.uint32,
)
metadata["general.name"] = config.get("_name_or_path", "llama").split("/")[-1]
metadata["general.architecture"] = "llama"
metadata["general.alignment"] = mx.array(32, dtype=mx.uint32)
# add metadata for vocab
metadata["tokenizer.ggml.model"] = "llama"
tokens = []
scores = []
toktypes = []
for text, score, toktype in vocab.all_tokens():
tokens.append(text)
scores.append(score)
toktypes.append(toktype.value)
assert len(tokens) == vocab.vocab_size
metadata["tokenizer.ggml.tokens"] = tokens
metadata["tokenizer.ggml.scores"] = mx.array(scores, dtype=mx.float32)
metadata["tokenizer.ggml.token_type"] = mx.array(toktypes, dtype=mx.uint32)
metadata["tokenizer.ggml.bos_token_id"] = mx.array(
vocab.tokenizer.bos_token_id, dtype=mx.uint32
)
metadata["tokenizer.ggml.eos_token_id"] = mx.array(
vocab.tokenizer.eos_token_id, dtype=mx.uint32
)
metadata["tokenizer.ggml.unknown_token_id"] = mx.array(
vocab.tokenizer.unk_token_id, dtype=mx.uint32
)
metadata = {k: v for k, v in metadata.items() if v is not None}
return metadata
def convert_to_gguf(
model_path: Union[str, Path],
weights: dict,
config: dict,
output_file_path: str,
):
if isinstance(model_path, str):
model_path = Path(model_path)
quantization = config.get("quantization", None)
if quantization:
raise NotImplementedError(
"Conversion of quantized models is not yet supported."
)
print("Converting to GGUF format")
# https://github.com/ggerganov/llama.cpp/blob/master/convert.py#L1182 seems relate to llama.cpp's multihead attention
weights = {
k: (
permute_weights(
v, config["num_attention_heads"], config["num_attention_heads"]
)
if "self_attn.q_proj.weight" in k
else (
permute_weights(
v, config["num_attention_heads"], config["num_key_value_heads"]
)
if "self_attn.k_proj.weight" in k
else v
)
)
for k, v in weights.items()
}
# rename weights for gguf format
weights = {translate_weight_names(k): v for k, v in weights.items()}
if not (model_path / "tokenizer.json").exists():
raise ValueError("Tokenizer json not found")
vocab = HfVocab.load(model_path)
metadata = prepare_metadata(config, vocab)
weights = {
k: (
v.astype(mx.float32).astype(mx.float16)
if v.dtype == mx.bfloat16
else v.astype(mx.float32) if "norm" in k else v
)
for k, v in weights.items()
}
output_file_path = output_file_path
mx.save_gguf(output_file_path, weights, metadata)
print(f"Converted GGUF model saved as: {output_file_path}")

278
llms/mlx_lm/lora.py Normal file
View File

@@ -0,0 +1,278 @@
# Copyright © 2024 Apple Inc.
import argparse
import math
import re
import types
from pathlib import Path
import mlx.nn as nn
import mlx.optimizers as optim
import numpy as np
import yaml
from .tokenizer_utils import TokenizerWrapper
from .tuner.datasets import load_dataset
from .tuner.trainer import TrainingArgs, TrainingCallback, evaluate, train
from .tuner.utils import (
apply_lora_layers,
build_schedule,
linear_to_lora_layers,
print_trainable_parameters,
)
from .utils import load, save_config
yaml_loader = yaml.SafeLoader
yaml_loader.add_implicit_resolver(
"tag:yaml.org,2002:float",
re.compile(
"""^(?:
[-+]?(?:[0-9][0-9_]*)\\.[0-9_]*(?:[eE][-+]?[0-9]+)?
|[-+]?(?:[0-9][0-9_]*)(?:[eE][-+]?[0-9]+)
|\\.[0-9_]+(?:[eE][-+][0-9]+)?
|[-+]?[0-9][0-9_]*(?::[0-5]?[0-9])+\\.[0-9_]*
|[-+]?\\.(?:inf|Inf|INF)
|\\.(?:nan|NaN|NAN))$""",
re.X,
),
list("-+0123456789."),
)
CONFIG_DEFAULTS = {
"model": "mlx_model",
"train": False,
"data": "data/",
"seed": 0,
"lora_layers": 16,
"batch_size": 4,
"iters": 1000,
"val_batches": 25,
"learning_rate": 1e-5,
"steps_per_report": 10,
"steps_per_eval": 200,
"resume_adapter_file": None,
"adapter_path": "adapters",
"save_every": 100,
"test": False,
"test_batches": 500,
"max_seq_length": 2048,
"lr_schedule": None,
"lora_parameters": {"rank": 8, "alpha": 16, "dropout": 0.0, "scale": 10.0},
"use_dora": False,
}
def build_parser():
parser = argparse.ArgumentParser(description="LoRA or QLoRA finetuning.")
parser.add_argument(
"--model",
help="The path to the local model directory or Hugging Face repo.",
)
# Training args
parser.add_argument(
"--train",
action="store_true",
help="Do training",
default=None,
)
parser.add_argument(
"--data",
type=str,
help="Directory with {train, valid, test}.jsonl files",
)
parser.add_argument(
"--lora-layers",
type=int,
help="Number of layers to fine-tune. Default is 16, use -1 for all.",
)
parser.add_argument("--batch-size", type=int, help="Minibatch size.")
parser.add_argument("--iters", type=int, help="Iterations to train for.")
parser.add_argument(
"--val-batches",
type=int,
help="Number of validation batches, -1 uses the entire validation set.",
)
parser.add_argument("--learning-rate", type=float, help="Adam learning rate.")
parser.add_argument(
"--steps-per-report",
type=int,
help="Number of training steps between loss reporting.",
)
parser.add_argument(
"--steps-per-eval",
type=int,
help="Number of training steps between validations.",
)
parser.add_argument(
"--resume-adapter-file",
type=str,
help="Load path to resume training with the given adapters.",
)
parser.add_argument(
"--adapter-path",
type=str,
help="Save/load path for the adapters.",
)
parser.add_argument(
"--save-every",
type=int,
help="Save the model every N iterations.",
)
parser.add_argument(
"--test",
action="store_true",
help="Evaluate on the test set after training",
default=None,
)
parser.add_argument(
"--test-batches",
type=int,
help="Number of test set batches, -1 uses the entire test set.",
)
parser.add_argument(
"--max-seq-length",
type=int,
help="Maximum sequence length.",
)
parser.add_argument(
"-c",
"--config",
default=None,
help="A YAML configuration file with the training options",
)
parser.add_argument(
"--grad-checkpoint",
action="store_true",
help="Use gradient checkpointing to reduce memory use.",
default=None,
)
parser.add_argument("--seed", type=int, default=None, help="The PRNG seed")
parser.add_argument(
"--use-dora", action="store_true", default=None, help="Use DoRA to finetune."
)
return parser
def train_model(
args,
model: nn.Module,
tokenizer: TokenizerWrapper,
train_set,
valid_set,
training_callback: TrainingCallback = None,
):
# Freeze all layers
model.freeze()
# Convert linear layers to lora layers and unfreeze in the process
linear_to_lora_layers(model, args.lora_layers, args.lora_parameters)
# Resume training the given adapters.
if args.resume_adapter_file is not None:
print(f"Loading pretrained adapters from {args.resume_adapter_file}")
model.load_weights(args.resume_adapter_file, strict=False)
print_trainable_parameters(model)
adapter_path = Path(args.adapter_path)
adapter_path.mkdir(parents=True, exist_ok=True)
adapter_file = adapter_path / "adapters.safetensors"
save_config(vars(args), adapter_path / "adapter_config.json")
# init training args
training_args = TrainingArgs(
batch_size=args.batch_size,
iters=args.iters,
val_batches=args.val_batches,
steps_per_report=args.steps_per_report,
steps_per_eval=args.steps_per_eval,
steps_per_save=args.save_every,
adapter_file=adapter_file,
max_seq_length=args.max_seq_length,
grad_checkpoint=args.grad_checkpoint,
)
model.train()
opt = optim.Adam(
learning_rate=(
build_schedule(args.lr_schedule) if args.lr_schedule else args.learning_rate
)
)
# Train model
train(
model=model,
tokenizer=tokenizer,
args=training_args,
optimizer=opt,
train_dataset=train_set,
val_dataset=valid_set,
training_callback=training_callback,
)
def evaluate_model(args, model: nn.Module, tokenizer: TokenizerWrapper, test_set):
model.eval()
test_loss = evaluate(
model=model,
dataset=test_set,
tokenizer=tokenizer,
batch_size=args.batch_size,
num_batches=args.test_batches,
max_seq_length=args.max_seq_length,
)
test_ppl = math.exp(test_loss)
print(f"Test loss {test_loss:.3f}, Test ppl {test_ppl:.3f}.")
def run(args, training_callback: TrainingCallback = None):
np.random.seed(args.seed)
print("Loading pretrained model")
model, tokenizer = load(args.model)
print("Loading datasets")
train_set, valid_set, test_set = load_dataset(args, tokenizer)
if args.test and not args.train:
# Allow testing without LoRA layers by providing empty path
if args.adapter_path != "":
apply_lora_layers(model, args.adapter_path)
elif args.train:
print("Training")
train_model(args, model, tokenizer, train_set, valid_set, training_callback)
else:
raise ValueError("Must provide at least one of --train or --test")
if args.test:
print("Testing")
evaluate_model(args, model, tokenizer, test_set)
def main():
parser = build_parser()
args = parser.parse_args()
config = args.config
args = vars(args)
if config:
print("Loading configuration file", config)
with open(config, "r") as file:
config = yaml.load(file, yaml_loader)
# Prefer parameters from command-line arguments
for k, v in config.items():
if args.get(k, None) is None:
args[k] = v
# Update defaults for unspecified parameters
for k, v in CONFIG_DEFAULTS.items():
if args.get(k, None) is None:
args[k] = v
run(types.SimpleNamespace(**args))
if __name__ == "__main__":
main()

121
llms/mlx_lm/manage.py Normal file
View File

@@ -0,0 +1,121 @@
import argparse
from typing import List, Union
from huggingface_hub import scan_cache_dir
from transformers.commands.user import tabulate
def ask_for_confirmation(message: str) -> bool:
y = ("y", "yes", "1")
n = ("n", "no", "0")
all_values = y + n + ("",)
full_message = f"{message} (Y/n) "
while True:
answer = input(full_message).lower()
if answer == "":
return False
if answer in y:
return True
if answer in n:
return False
print(f"Invalid input. Must be one of {all_values}")
def main():
parser = argparse.ArgumentParser(description="MLX Model Cache.")
parser.add_argument(
"--scan",
action="store_true",
help="Scan Hugging Face cache for mlx models.",
)
parser.add_argument(
"--delete",
action="store_true",
help="Delete models matching the given pattern.",
)
parser.add_argument(
"--pattern",
type=str,
help="Model repos contain the pattern.",
default="mlx",
)
args = parser.parse_args()
if args.scan:
print(
"Scanning Hugging Face cache for models with" f'pattern "{args.pattern}".'
)
hf_cache_info = scan_cache_dir()
print(
tabulate(
rows=[
[
repo.repo_id,
repo.repo_type,
"{:>12}".format(repo.size_on_disk_str),
repo.nb_files,
repo.last_accessed_str,
repo.last_modified_str,
str(repo.repo_path),
]
for repo in sorted(
hf_cache_info.repos, key=lambda repo: repo.repo_path
)
if args.pattern in repo.repo_id
],
headers=[
"REPO ID",
"REPO TYPE",
"SIZE ON DISK",
"NB FILES",
"LAST_ACCESSED",
"LAST_MODIFIED",
"LOCAL PATH",
],
)
)
if args.delete:
print(f'Deleting models matching pattern "{args.pattern}"')
hf_cache_info = scan_cache_dir()
repos = [
repo
for repo in sorted(hf_cache_info.repos, key=lambda repo: repo.repo_path)
if args.pattern in repo.repo_id
]
if repos:
print(
tabulate(
rows=[
[
repo.repo_id,
str(repo.repo_path),
]
for repo in repos
],
headers=[
"REPO ID",
"LOCAL PATH",
],
)
)
confirmed = ask_for_confirmation(f"Confirm deletion ?")
if confirmed:
for model_info in repos:
for revision in sorted(
model_info.revisions, key=lambda revision: revision.commit_hash
):
strategy = hf_cache_info.delete_revisions(revision.commit_hash)
strategy.execute()
print("Model(s) deleted.")
else:
print("Deletion is cancelled. Do nothing.")
else:
print(f"No models found.")
if __name__ == "__main__":
main()

172
llms/mlx_lm/merge.py Normal file
View File

@@ -0,0 +1,172 @@
# Copyright © 2023-2024 Apple Inc.
import argparse
import glob
import shutil
from pathlib import Path
from typing import Optional
import mlx.core as mx
import mlx.nn as nn
import numpy as np
import yaml
from mlx.utils import tree_flatten, tree_map
from .utils import (
fetch_from_hub,
get_model_path,
save_config,
save_weights,
upload_to_hub,
)
def configure_parser() -> argparse.ArgumentParser:
"""
Configures and returns the argument parser for the script.
Returns:
argparse.ArgumentParser: Configured argument parser.
"""
parser = argparse.ArgumentParser(description="Merge multiple models.")
parser.add_argument("--config", type=str, help="Path to the YAML config.")
parser.add_argument(
"--mlx-path",
type=str,
default="mlx_merged_model",
help="Path to save the MLX model.",
)
parser.add_argument(
"--upload-repo",
help="The Hugging Face repo to upload the model to.",
type=str,
default=None,
)
return parser
def slerp(t, w1, w2, eps=1e-5):
"""
Spherical linear interpolation
Args:
t (float): Interpolation weight in [0.0, 1.0]
w1 (mx.array): First input
w2 (mx.array): Second input
eps (float): Constant for numerical stability
Returns:
mx.array: Interpolated result
"""
t = float(t)
if t == 0:
return w1
elif t == 1:
return w2
# Normalize
v1 = w1 / mx.linalg.norm(w1)
v2 = w2 / mx.linalg.norm(w2)
# Angle
dot = mx.clip((v1 * v2).sum(), 0.0, 1.0)
theta = mx.arccos(dot)
sin_theta = mx.sin(theta + eps)
s1 = mx.sin(theta * (1 - t)) / sin_theta
s2 = mx.sin(theta * t) / sin_theta
return s1 * w1 + s2 * w2
def merge_models(base_model: nn.Module, model: nn.Module, config: dict):
method = config.get("method", None)
if method != "slerp":
raise ValueError(f"Merge method {method} not supported")
num_layers = len(model.layers)
def unpack_values(vals):
if isinstance(vals, (int, float)):
return np.full(num_layers, vals)
bins = len(vals) - 1
sizes = [num_layers // bins] * bins
sizes[-1] = num_layers - sum(sizes[:-1])
return np.concatenate(
[np.linspace(v1, v2, s) for v1, v2, s in zip(vals[:-1], vals[1:], sizes)]
)
param_list = config["parameters"]["t"]
params = {}
filter_keys = set()
for pl in param_list[:-1]:
params[pl["filter"]] = unpack_values(pl["value"])
filter_keys.add(pl["filter"])
default = unpack_values(param_list[-1]["value"])
for e in range(num_layers):
bl = base_model.layers[e]
l = model.layers[e]
base_weights = bl.parameters()
weights = l.parameters()
for k, w1 in base_weights.items():
w2 = weights[k]
t = params.get(k, default)[e]
base_weights[k] = tree_map(lambda x, y: slerp(t, x, y), w1, w2)
base_model.update(base_weights)
def merge(
config: str,
mlx_path: str = "mlx_model",
upload_repo: Optional[str] = None,
):
with open(config, "r") as fid:
merge_conf = yaml.safe_load(fid)
print("[INFO] Loading")
model_paths = merge_conf.get("models", [])
if len(model_paths) < 2:
raise ValueError(f"Expected at least 2 models, got {len(model_paths)}.")
# Load all models
base_hf_path = model_paths[0]
base_path = get_model_path(base_hf_path)
base_model, base_config, tokenizer = fetch_from_hub(base_path, lazy=True)
models = []
for mp in model_paths[1:]:
model, model_config, _ = fetch_from_hub(get_model_path(mp), lazy=True)
base_type = base_config["model_type"]
model_type = model_config["model_type"]
if base_type != model_type:
raise ValueError(
f"Can only merge models of the same type,"
f" but got {base_type} and {model_type}."
)
models.append(model)
# Merge models into base model
for m in models:
merge_models(base_model, m, merge_conf)
# Save base model
mlx_path = Path(mlx_path)
weights = dict(tree_flatten(base_model.parameters()))
del models, base_model
save_weights(mlx_path, weights, donate_weights=True)
py_files = glob.glob(str(base_path / "*.py"))
for file in py_files:
shutil.copy(file, mlx_path)
tokenizer.save_pretrained(mlx_path)
save_config(config, config_path=mlx_path / "config.json")
if upload_repo is not None:
upload_to_hub(mlx_path, upload_repo, base_hf_path)
def main():
parser = configure_parser()
args = parser.parse_args()
merge(**vars(args))
if __name__ == "__main__":
main()

View File

View File

@@ -0,0 +1,56 @@
import inspect
from dataclasses import dataclass
import mlx.core as mx
def create_additive_causal_mask(N: int, offset: int = 0):
rinds = mx.arange(offset + N)
linds = mx.arange(offset, offset + N) if offset else rinds
mask = linds[:, None] < rinds[None]
return mask * -1e9
class KVCache:
def __init__(self, head_dim, n_kv_heads):
self.n_kv_heads = n_kv_heads
self.head_dim = head_dim
self.keys = None
self.values = None
self.offset = 0
self.step = 256
def update_and_fetch(self, keys, values):
prev = self.offset
if self.keys is None or (prev + keys.shape[2]) > self.keys.shape[2]:
n_steps = (self.step + keys.shape[2] - 1) // self.step
shape = (1, self.n_kv_heads, n_steps * self.step, self.head_dim)
new_k = mx.zeros(shape, keys.dtype)
new_v = mx.zeros(shape, values.dtype)
if self.keys is not None:
if prev % self.step != 0:
self.keys = self.keys[..., :prev, :]
self.values = self.values[..., :prev, :]
self.keys = mx.concatenate([self.keys, new_k], axis=2)
self.values = mx.concatenate([self.values, new_v], axis=2)
else:
self.keys, self.values = new_k, new_v
self.offset += keys.shape[2]
self.keys[..., prev : self.offset, :] = keys
self.values[..., prev : self.offset, :] = values
return self.keys[..., : self.offset, :], self.values[..., : self.offset, :]
@dataclass
class BaseModelArgs:
@classmethod
def from_dict(cls, params):
return cls(
**{
k: v
for k, v in params.items()
if k in inspect.signature(cls).parameters
}
)

View File

@@ -0,0 +1,201 @@
from dataclasses import dataclass
from typing import Optional, Tuple
import mlx.core as mx
import mlx.nn as nn
from .base import BaseModelArgs
@dataclass
class ModelArgs(BaseModelArgs):
model_type: str
hidden_size: int = 8192
num_hidden_layers: int = 40
intermediate_size: int = 22528
num_attention_heads: int = 64
num_key_value_heads: int = 64
rope_theta: float = 8000000.0
vocab_size: int = 256000
layer_norm_eps: float = 1e-05
logit_scale: float = 0.0625
attention_bias: bool = False
layer_norm_bias: bool = False
use_qk_norm: bool = False
class LayerNorm2D(nn.Module):
def __init__(self, d1, d2, eps):
super().__init__()
self.weight = mx.zeros((d1, d2))
self.eps = eps
def __call__(self, x):
return self.weight * mx.fast.layer_norm(x, None, None, self.eps)
class Attention(nn.Module):
def __init__(self, args: ModelArgs):
super().__init__()
self.args = args
dim = args.hidden_size
self.n_heads = n_heads = args.num_attention_heads
self.n_kv_heads = n_kv_heads = args.num_key_value_heads
head_dim = args.hidden_size // args.num_attention_heads
self.scale = head_dim**-0.5
attetion_bias = args.attention_bias
self.q_proj = nn.Linear(dim, n_heads * head_dim, bias=attetion_bias)
self.k_proj = nn.Linear(dim, n_kv_heads * head_dim, bias=attetion_bias)
self.v_proj = nn.Linear(dim, n_kv_heads * head_dim, bias=attetion_bias)
self.o_proj = nn.Linear(n_heads * head_dim, dim, bias=attetion_bias)
self.use_qk_norm = args.use_qk_norm
if self.use_qk_norm:
self.q_norm = LayerNorm2D(self.n_heads, head_dim, eps=args.layer_norm_eps)
self.k_norm = LayerNorm2D(
self.n_kv_heads, head_dim, eps=args.layer_norm_eps
)
self.rope = nn.RoPE(head_dim, traditional=True, base=args.rope_theta)
def __call__(
self,
x: mx.array,
mask: Optional[mx.array] = None,
cache: Optional[Tuple[mx.array, mx.array]] = None,
) -> mx.array:
B, L, D = x.shape
queries, keys, values = self.q_proj(x), self.k_proj(x), self.v_proj(x)
queries = queries.reshape(B, L, self.n_heads, -1)
keys = keys.reshape(B, L, self.n_kv_heads, -1)
if self.use_qk_norm:
queries = self.q_norm(queries)
keys = self.k_norm(keys)
queries = queries.transpose(0, 2, 1, 3)
keys = keys.transpose(0, 2, 1, 3)
values = values.reshape(B, L, self.n_kv_heads, -1).transpose(0, 2, 1, 3)
if cache is not None:
queries = self.rope(queries, offset=cache.offset)
keys = self.rope(keys, offset=cache.offset)
keys, values = cache.update_and_fetch(keys, values)
else:
queries = self.rope(queries)
keys = self.rope(keys)
output = mx.fast.scaled_dot_product_attention(
queries, keys, values, scale=self.scale, mask=mask
)
output = output.transpose(0, 2, 1, 3).reshape(B, L, -1)
return self.o_proj(output)
class MLP(nn.Module):
def __init__(self, dim, hidden_dim):
super().__init__()
self.gate_proj = nn.Linear(dim, hidden_dim, bias=False)
self.up_proj = nn.Linear(dim, hidden_dim, bias=False)
self.down_proj = nn.Linear(hidden_dim, dim, bias=False)
def __call__(self, x):
return self.down_proj(nn.silu(self.gate_proj(x)) * self.up_proj(x))
class TransformerBlock(nn.Module):
def __init__(self, args: ModelArgs):
super().__init__()
self.hidden_size = args.hidden_size
self.n_heads = args.num_attention_heads
self.self_attn = Attention(args)
self.mlp = MLP(args.hidden_size, args.intermediate_size)
self.input_layernorm = nn.LayerNorm(
args.hidden_size, eps=args.layer_norm_eps, bias=args.layer_norm_bias
)
self.args = args
def __call__(
self,
x: mx.array,
mask: Optional[mx.array] = None,
cache: Optional[Tuple[mx.array, mx.array]] = None,
) -> mx.array:
h = self.input_layernorm(x)
attn_h = self.self_attn(h, mask, cache)
ff_h = self.mlp(h)
return attn_h + ff_h + x
class CohereModel(nn.Module):
def __init__(self, args: ModelArgs):
super().__init__()
self.args = args
self.vocab_size = args.vocab_size
self.num_hidden_layers = args.num_hidden_layers
assert self.vocab_size > 0
self.embed_tokens = nn.Embedding(args.vocab_size, args.hidden_size)
self.layers = [
TransformerBlock(args=args) for _ in range(args.num_hidden_layers)
]
self.norm = nn.LayerNorm(
args.hidden_size, eps=args.layer_norm_eps, bias=args.layer_norm_bias
)
def __call__(
self,
inputs: mx.array,
cache=None,
):
h = self.embed_tokens(inputs)
mask = None
if h.shape[1] > 1:
mask = nn.MultiHeadAttention.create_additive_causal_mask(h.shape[1])
mask = mask.astype(h.dtype)
if cache is None:
cache = [None] * len(self.layers)
for layer, c in zip(self.layers, cache):
h = layer(h, mask, c)
return self.norm(h)
class Model(nn.Module):
def __init__(self, args: ModelArgs):
super().__init__()
self.model_type = args.model_type
self.model = CohereModel(args)
self.args = args
def __call__(
self,
inputs: mx.array,
cache=None,
):
out = self.model(inputs, cache)
out = self.model.embed_tokens.as_linear(out)
out = out * self.model.args.logit_scale
return out
@property
def layers(self):
return self.model.layers
@property
def head_dim(self):
return self.args.hidden_size // self.args.num_attention_heads
@property
def n_kv_heads(self):
return self.args.num_key_value_heads

261
llms/mlx_lm/models/dbrx.py Normal file
View File

@@ -0,0 +1,261 @@
from dataclasses import dataclass
from typing import Optional, Tuple
import mlx.core as mx
import mlx.nn as nn
import numpy as np
from .base import BaseModelArgs
@dataclass
class ModelArgs(BaseModelArgs):
model_type: str
vocab_size: int
d_model: int
ffn_config: dict
attn_config: dict
n_layers: int
n_heads: int
class Attention(nn.Module):
def __init__(self, args: ModelArgs):
super().__init__()
self.num_heads = args.n_heads
self.d_model = args.d_model
self.head_dim = args.d_model // args.n_heads
self.num_key_value_heads = args.attn_config["kv_n_heads"]
self.clip_qkv = args.attn_config["clip_qkv"]
self.rope_theta = args.attn_config["rope_theta"]
self.scale = self.head_dim**-0.5
self.Wqkv = nn.Linear(
args.d_model,
(self.num_key_value_heads * 2 + self.num_heads) * self.head_dim,
bias=False,
)
self.out_proj = nn.Linear(args.d_model, args.d_model, bias=False)
self.rope = nn.RoPE(
self.head_dim,
traditional=False,
base=self.rope_theta,
)
def __call__(
self,
x: mx.array,
mask: Optional[mx.array] = None,
cache: Optional[Tuple[mx.array, mx.array]] = None,
) -> mx.array:
qkv = self.Wqkv(x)
qkv = mx.clip(qkv, a_min=-self.clip_qkv, a_max=self.clip_qkv)
splits = [self.d_model, self.d_model + self.head_dim * self.num_key_value_heads]
queries, keys, values = mx.split(qkv, splits, axis=-1)
B, L, D = x.shape
# Prepare the queries, keys and values for the attention computation
queries = queries.reshape(B, L, self.num_heads, -1).transpose(0, 2, 1, 3)
keys = keys.reshape(B, L, self.num_key_value_heads, -1).transpose(0, 2, 1, 3)
values = values.reshape(B, L, self.num_key_value_heads, -1).transpose(
0, 2, 1, 3
)
if cache is not None:
queries = self.rope(queries, offset=cache.offset)
keys = self.rope(keys, offset=cache.offset)
keys, values = cache.update_and_fetch(keys, values)
else:
queries = self.rope(queries)
keys = self.rope(keys)
output = mx.fast.scaled_dot_product_attention(
queries, keys, values, scale=self.scale, mask=mask
)
output = output.transpose(0, 2, 1, 3).reshape(B, L, -1)
return self.out_proj(output)
class NormAttnNorm(nn.Module):
def __init__(self, args: ModelArgs):
super().__init__()
self.norm_1 = nn.LayerNorm(args.d_model, bias=False)
self.norm_2 = nn.LayerNorm(args.d_model, bias=False)
self.attn = Attention(args)
def __call__(
self,
x: mx.array,
mask: Optional[mx.array] = None,
cache: Optional[Tuple[mx.array, mx.array]] = None,
) -> mx.array:
h = self.attn(self.norm_1(x), mask=mask, cache=cache)
x = h + x
return x, self.norm_2(x)
class MLP(nn.Module):
def __init__(self, d_model: int, ffn_dim: int):
super().__init__()
self.v1 = nn.Linear(d_model, ffn_dim, bias=False)
self.w1 = nn.Linear(d_model, ffn_dim, bias=False)
self.w2 = nn.Linear(ffn_dim, d_model, bias=False)
self.act_fn = nn.silu
def __call__(self, x: mx.array) -> mx.array:
current_hidden_states = self.act_fn(self.w1(x)) * self.v1(x)
current_hidden_states = self.w2(current_hidden_states)
return current_hidden_states
class Router(nn.Module):
def __init__(self, d_model: int, num_experts: int):
super().__init__()
self.layer = nn.Linear(d_model, num_experts, bias=False)
def __call__(self, x: mx.array):
return self.layer(x)
class SparseMoeBlock(nn.Module):
def __init__(self, args: ModelArgs):
super().__init__()
self.d_model = args.d_model
self.ffn_dim = args.ffn_config["ffn_hidden_size"]
self.num_experts = args.ffn_config["moe_num_experts"]
self.num_experts_per_tok = args.ffn_config["moe_top_k"]
self.router = Router(self.d_model, self.num_experts)
self.experts = [
MLP(self.d_model, self.ffn_dim) for _ in range(self.num_experts)
]
def __call__(self, x: mx.array) -> mx.array:
ne = self.num_experts_per_tok
orig_shape = x.shape
x = x.reshape(-1, x.shape[-1])
gates = self.router(x)
gates = mx.softmax(gates.astype(mx.float32), axis=-1)
inds = mx.stop_gradient(mx.argpartition(-gates, kth=ne - 1, axis=-1)[:, :ne])
scores = mx.take_along_axis(gates, inds, axis=-1)
scores = scores / mx.linalg.norm(scores, ord=1, axis=-1, keepdims=True)
scores = scores.astype(x.dtype)
if self.training:
inds = np.array(inds)
y = mx.zeros((x.shape[0], ne, x.shape[-1]), x.dtype)
for e, expert in enumerate(self.experts):
idx1, idx2 = map(mx.array, np.where(inds == e))
if idx1.size == 0:
continue
y[idx1, idx2] = expert(x[idx1])
y = (y * scores[:, :, None]).sum(axis=1)
else:
y = []
for xt, st, it in zip(x, scores, inds.tolist()):
yt = mx.stack([self.experts[e](xt) for e in it], axis=-1)
yt = (yt * st).sum(axis=-1)
y.append(yt)
y = mx.stack(y, axis=0)
return y.reshape(orig_shape)
class DecoderLayer(nn.Module):
def __init__(self, args: ModelArgs):
super().__init__()
self.ffn = SparseMoeBlock(args)
self.norm_attn_norm = NormAttnNorm(args)
def __call__(
self,
x: mx.array,
mask: Optional[mx.array] = None,
cache: Optional[Tuple[mx.array, mx.array]] = None,
) -> mx.array:
r, h = self.norm_attn_norm(x, mask, cache)
out = self.ffn(h) + r
return out
class DBRX(nn.Module):
def __init__(self, args: ModelArgs):
super().__init__()
self.vocab_size = args.vocab_size
self.wte = nn.Embedding(args.vocab_size, args.d_model)
self.blocks = [DecoderLayer(args=args) for _ in range(args.n_layers)]
self.norm_f = nn.LayerNorm(args.d_model, bias=False)
def __call__(
self,
inputs: mx.array,
cache=None,
):
h = self.wte(inputs)
mask = None
T = h.shape[1]
if T > 1:
mask = nn.MultiHeadAttention.create_additive_causal_mask(T)
mask = mask.astype(h.dtype)
if cache is None:
cache = [None] * len(self.blocks)
for layer, c in zip(self.blocks, cache):
h = layer(h, mask, c)
return self.norm_f(h)
class Model(nn.Module):
def __init__(self, args: ModelArgs):
super().__init__()
self.model_type = args.model_type
self.transformer = DBRX(args)
self.lm_head = nn.Linear(args.d_model, args.vocab_size, bias=False)
self.args = args
def __call__(
self,
inputs: mx.array,
cache=None,
):
out = self.transformer(inputs, cache)
return self.lm_head(out)
@property
def layers(self):
return self.transformer.blocks
def sanitize(self, weights):
# Split experts into sub matrices
num_experts = self.args.ffn_config["moe_num_experts"]
dim = self.args.ffn_config["ffn_hidden_size"]
pattern = "experts.mlp"
new_weights = {k: v for k, v in weights.items() if pattern not in k}
for k, v in weights.items():
if pattern in k:
experts = [
(k.replace(".mlp", f".{e}") + ".weight", sv)
for e, sv in enumerate(mx.split(v, num_experts, axis=0))
]
if k.endswith("w2"):
experts = [(s, sv.T) for s, sv in experts]
new_weights.update(experts)
return new_weights
@property
def head_dim(self):
return self.args.d_model // self.args.n_heads
@property
def n_kv_heads(self):
return self.args.attn_config["kv_n_heads"]

184
llms/mlx_lm/models/gemma.py Normal file
View File

@@ -0,0 +1,184 @@
from dataclasses import dataclass
from typing import Optional, Tuple
import mlx.core as mx
import mlx.nn as nn
from .base import BaseModelArgs
@dataclass
class ModelArgs(BaseModelArgs):
model_type: str
hidden_size: int
num_hidden_layers: int
intermediate_size: int
num_attention_heads: int
head_dim: int
rms_norm_eps: float
vocab_size: int
num_key_value_heads: int
rope_theta: float = 10000
rope_traditional: bool = False
class RMSNorm(nn.Module):
def __init__(self, dims: int, eps: float = 1e-5):
super().__init__()
self.weight = mx.ones((dims,))
self.eps = eps
def __call__(self, x):
return mx.fast.rms_norm(x, 1.0 + self.weight, self.eps)
class Attention(nn.Module):
def __init__(self, args: ModelArgs):
super().__init__()
dim = args.hidden_size
self.n_heads = n_heads = args.num_attention_heads
self.n_kv_heads = n_kv_heads = args.num_key_value_heads
self.head_dim = head_dim = args.head_dim
self.scale = head_dim**-0.5
self.q_proj = nn.Linear(dim, n_heads * head_dim, bias=False)
self.k_proj = nn.Linear(dim, n_kv_heads * head_dim, bias=False)
self.v_proj = nn.Linear(dim, n_kv_heads * head_dim, bias=False)
self.o_proj = nn.Linear(n_heads * head_dim, dim, bias=False)
self.rope = nn.RoPE(
head_dim,
traditional=args.rope_traditional,
base=args.rope_theta,
)
def __call__(
self,
x: mx.array,
mask: Optional[mx.array] = None,
cache: Optional[Tuple[mx.array, mx.array]] = None,
) -> mx.array:
B, L, D = x.shape
queries, keys, values = self.q_proj(x), self.k_proj(x), self.v_proj(x)
# Prepare the queries, keys and values for the attention computation
queries = queries.reshape(B, L, self.n_heads, -1).transpose(0, 2, 1, 3)
keys = keys.reshape(B, L, self.n_kv_heads, -1).transpose(0, 2, 1, 3)
values = values.reshape(B, L, self.n_kv_heads, -1).transpose(0, 2, 1, 3)
if cache is not None:
queries = self.rope(queries, offset=cache.offset)
keys = self.rope(keys, offset=cache.offset)
keys, values = cache.update_and_fetch(keys, values)
else:
queries = self.rope(queries)
keys = self.rope(keys)
output = mx.fast.scaled_dot_product_attention(
queries, keys, values, scale=self.scale, mask=mask
)
output = output.transpose(0, 2, 1, 3).reshape(B, L, -1)
return self.o_proj(output)
class MLP(nn.Module):
def __init__(self, dim, hidden_dim):
super().__init__()
self.gate_proj = nn.Linear(dim, hidden_dim, bias=False)
self.down_proj = nn.Linear(hidden_dim, dim, bias=False)
self.up_proj = nn.Linear(dim, hidden_dim, bias=False)
def __call__(self, x) -> mx.array:
return self.down_proj(nn.gelu(self.gate_proj(x)) * self.up_proj(x))
class TransformerBlock(nn.Module):
def __init__(self, args: ModelArgs):
super().__init__()
self.num_attention_heads = args.num_attention_heads
self.hidden_size = args.hidden_size
self.self_attn = Attention(args)
self.mlp = MLP(args.hidden_size, args.intermediate_size)
self.input_layernorm = RMSNorm(args.hidden_size, eps=args.rms_norm_eps)
self.post_attention_layernorm = RMSNorm(args.hidden_size, eps=args.rms_norm_eps)
self.args = args
def __call__(
self,
x: mx.array,
mask: Optional[mx.array] = None,
cache: Optional[Tuple[mx.array, mx.array]] = None,
) -> mx.array:
r = self.self_attn(self.input_layernorm(x), mask, cache)
h = x + r
r = self.mlp(self.post_attention_layernorm(h))
out = h + r
return out
class GemmaModel(nn.Module):
def __init__(self, args: ModelArgs):
super().__init__()
self.args = args
self.vocab_size = args.vocab_size
self.num_hidden_layers = args.num_hidden_layers
assert self.vocab_size > 0
self.embed_tokens = nn.Embedding(args.vocab_size, args.hidden_size)
self.layers = [
TransformerBlock(args=args) for _ in range(args.num_hidden_layers)
]
self.norm = RMSNorm(args.hidden_size, eps=args.rms_norm_eps)
def __call__(
self,
inputs: mx.array,
cache=None,
):
h = self.embed_tokens(inputs)
h = h * (self.args.hidden_size**0.5)
mask = None
if h.shape[1] > 1:
mask = nn.MultiHeadAttention.create_additive_causal_mask(h.shape[1])
mask = mask.astype(h.dtype)
if cache is None:
cache = [None] * len(self.layers)
for layer, c in zip(self.layers, cache):
h = layer(h, mask, c)
return self.norm(h)
class Model(nn.Module):
def __init__(self, args: ModelArgs):
super().__init__()
self.model_type = args.model_type
self.model = GemmaModel(args)
self.args = args
def __call__(
self,
inputs: mx.array,
cache=None,
):
out = self.model(inputs, cache)
out = self.model.embed_tokens.as_linear(out)
return out
@property
def layers(self):
return self.model.layers
@property
def head_dim(self):
return self.args.head_dim
@property
def n_kv_heads(self):
return self.args.num_key_value_heads

207
llms/mlx_lm/models/gpt2.py Normal file
View File

@@ -0,0 +1,207 @@
from dataclasses import dataclass
from typing import Dict, Optional, Tuple, Union
import mlx.core as mx
import mlx.nn as nn
import numpy as np
from .base import BaseModelArgs, create_additive_causal_mask
@dataclass
class ModelArgs(BaseModelArgs):
model_type: str
n_ctx: int
n_embd: int
n_head: int
n_layer: int
n_positions: int
layer_norm_epsilon: float
vocab_size: int
num_key_value_heads: int = None
def __post_init__(self):
if self.num_key_value_heads is None:
self.num_key_value_heads = self.n_head
class Attention(nn.Module):
def __init__(self, args: ModelArgs):
super().__init__()
assert args.n_embd % args.n_head == 0, "n_embd must be divisible by n_head"
self.n_embd = args.n_embd
self.n_head = args.n_head
self.head_dim = self.n_embd // self.n_head
self.scale = self.head_dim**-0.5
self.c_attn = nn.Linear(self.n_embd, 3 * self.n_embd, bias=True)
self.c_proj = nn.Linear(self.n_embd, self.n_embd, bias=True)
def __call__(
self,
x: mx.array,
mask: Optional[mx.array] = None,
cache: Optional[Tuple[mx.array, mx.array]] = None,
) -> mx.array:
B, L, D = x.shape
qkv = self.c_attn(x)
queries, keys, values = mx.split(qkv, 3, axis=-1)
# Prepare the queries, keys and values for the attention computation
queries = queries.reshape(B, L, self.n_head, -1).transpose(0, 2, 1, 3)
keys = keys.reshape(B, L, self.n_head, -1).transpose(0, 2, 1, 3)
values = values.reshape(B, L, self.n_head, -1).transpose(0, 2, 1, 3)
if cache is not None:
keys, values = cache.update_and_fetch(keys, values)
output = mx.fast.scaled_dot_product_attention(
queries, keys, values, scale=self.scale, mask=mask
)
output = output.transpose(0, 2, 1, 3).reshape(B, L, -1)
return self.c_proj(output)
class MLP(nn.Module):
def __init__(self, args: ModelArgs):
super().__init__()
self.n_embd = args.n_embd
self.c_fc = nn.Linear(self.n_embd, 4 * self.n_embd)
self.c_proj = nn.Linear(4 * self.n_embd, self.n_embd)
def __call__(self, x) -> mx.array:
return self.c_proj(nn.gelu_approx(self.c_fc(x)))
class TransformerBlock(nn.Module):
def __init__(self, args: ModelArgs):
super().__init__()
self.n_head = args.n_head
self.n_embd = args.n_embd
self.layer_norm_epsilon = args.layer_norm_epsilon
self.attn = Attention(args)
self.mlp = MLP(args)
self.ln_1 = nn.LayerNorm(
self.n_embd,
eps=self.layer_norm_epsilon,
)
self.ln_2 = nn.LayerNorm(self.n_embd, eps=self.layer_norm_epsilon)
def __call__(
self,
x: mx.array,
mask: Optional[mx.array] = None,
cache: Optional[Tuple[mx.array, mx.array]] = None,
) -> mx.array:
r = self.attn(self.ln_1(x), mask, cache)
h = x + r
r = self.mlp(self.ln_2(h))
out = h + r
return out
class GPT2Model(nn.Module):
def __init__(self, args: ModelArgs):
super().__init__()
self.n_embd = args.n_embd
self.n_positions = args.n_positions
self.vocab_size = args.vocab_size
self.n_layer = args.n_layer
self.layer_norm_epsilon = args.layer_norm_epsilon
assert self.vocab_size > 0
self.wte = nn.Embedding(self.vocab_size, self.n_embd)
self.wpe = nn.Embedding(self.n_positions, self.n_embd)
self.h = [TransformerBlock(args=args) for _ in range(self.n_layer)]
self.ln_f = nn.LayerNorm(self.n_embd, eps=self.layer_norm_epsilon)
def __call__(
self,
inputs: mx.array,
cache=None,
):
_, L = inputs.shape
hidden_states = self.wte(inputs)
mask = None
if hidden_states.shape[1] > 1:
position_ids = mx.array(np.arange(L))
hidden_states += self.wpe(position_ids)
mask = create_additive_causal_mask(
hidden_states.shape[1], cache[0].offset if cache is not None else 0
)
mask = mask.astype(hidden_states.dtype)
if cache is None:
cache = [None] * len(self.h)
for layer, c in zip(self.h, cache):
hidden_states = layer(hidden_states, mask, cache=c)
return self.ln_f(hidden_states)
class Model(nn.Module):
def __init__(self, args: ModelArgs):
super().__init__()
self.args = args
self.model_type = args.model_type
self.model = GPT2Model(args)
def __call__(
self,
inputs: mx.array,
cache=None,
):
out = self.model(inputs, cache)
out = self.model.wte.as_linear(out)
return out
def sanitize(self, weights):
new_weights = {}
for i in range(self.args.n_layer):
if f"h.{i}.attn.bias" in weights:
del weights[f"h.{i}.attn.bias"]
if f"h.{i}.attn.c_attn.weight" in weights:
weights[f"h.{i}.attn.c_attn.weight"] = weights[
f"h.{i}.attn.c_attn.weight"
].transpose(1, 0)
if f"h.{i}.attn.c_proj.weight" in weights:
weights[f"h.{i}.attn.c_proj.weight"] = weights[
f"h.{i}.attn.c_proj.weight"
].transpose(1, 0)
if f"h.{i}.mlp.c_fc.weight" in weights:
weights[f"h.{i}.mlp.c_fc.weight"] = weights[
f"h.{i}.mlp.c_fc.weight"
].transpose(1, 0)
if f"h.{i}.mlp.c_proj.weight" in weights:
weights[f"h.{i}.mlp.c_proj.weight"] = weights[
f"h.{i}.mlp.c_proj.weight"
].transpose(1, 0)
for weight in weights:
if not weight.startswith("model."):
new_weights[f"model.{weight}"] = weights[weight]
else:
new_weights[weight] = weights[weight]
return new_weights
@property
def layers(self):
return self.model.h
@property
def head_dim(self):
return self.args.n_embd // self.args.n_head
@property
def n_kv_heads(self):
return self.args.num_key_value_heads

View File

@@ -0,0 +1,195 @@
from dataclasses import dataclass
from typing import Dict, Optional, Tuple, Union
import mlx.core as mx
import mlx.nn as nn
import numpy as np
from .base import BaseModelArgs, create_additive_causal_mask
@dataclass
class ModelArgs(BaseModelArgs):
model_type: str
n_embd: int
n_layer: int
n_inner: int
n_head: int
n_positions: int
layer_norm_epsilon: float
vocab_size: int
num_key_value_heads: int = None
multi_query: bool = True
attention_bias: bool = True
mlp_bias: bool = True
tie_word_embeddings: bool = True
def __post_init__(self):
if self.num_key_value_heads is None:
self.num_key_value_heads = 1 if self.multi_query else self.n_head
class Attention(nn.Module):
def __init__(self, args: ModelArgs):
super().__init__()
self.dim = dim = args.n_embd
self.n_heads = n_heads = args.n_head
self.n_kv_heads = n_kv_heads = 1 if args.multi_query else args.n_head
self.head_dim = head_dim = dim // n_heads
self.kv_dim = n_kv_heads * head_dim
self.scale = head_dim**-0.5
if hasattr(args, "attention_bias"):
attention_bias = args.attention_bias
else:
attention_bias = False
self.c_attn = nn.Linear(dim, dim + 2 * self.kv_dim, bias=attention_bias)
self.c_proj = nn.Linear(dim, dim, bias=attention_bias)
def __call__(
self,
x: mx.array,
mask: Optional[mx.array] = None,
cache: Optional[Tuple[mx.array, mx.array]] = None,
) -> mx.array:
B, L, D = x.shape
qkv = self.c_attn(x)
queries, keys, values = mx.split(
qkv, [self.dim, self.dim + self.kv_dim], axis=-1
)
# Prepare the queries, keys and values for the attention computation
queries = queries.reshape(B, L, self.n_heads, -1).transpose(0, 2, 1, 3)
keys = keys.reshape(B, L, self.n_kv_heads, -1).transpose(0, 2, 1, 3)
values = values.reshape(B, L, self.n_kv_heads, -1).transpose(0, 2, 1, 3)
if cache is not None:
keys, values = cache.update_and_fetch(keys, values)
output = mx.fast.scaled_dot_product_attention(
queries, keys, values, scale=self.scale, mask=mask
)
output = output.transpose(0, 2, 1, 3).reshape(B, L, -1)
return self.c_proj(output)
class MLP(nn.Module):
def __init__(self, args: ModelArgs):
super().__init__()
dim = args.n_embd
hidden_dim = args.n_inner
if hasattr(args, "mlp_bias"):
mlp_bias = args.mlp_bias
else:
mlp_bias = False
self.c_fc = nn.Linear(dim, hidden_dim, bias=mlp_bias)
self.c_proj = nn.Linear(hidden_dim, dim, bias=mlp_bias)
def __call__(self, x) -> mx.array:
return self.c_proj(nn.gelu(self.c_fc(x)))
class TransformerBlock(nn.Module):
def __init__(self, args: ModelArgs):
super().__init__()
self.n_head = args.n_head
self.n_embd = args.n_embd
self.attn = Attention(args)
self.mlp = MLP(args)
self.ln_1 = nn.LayerNorm(args.n_embd, eps=args.layer_norm_epsilon)
self.ln_2 = nn.LayerNorm(args.n_embd, eps=args.layer_norm_epsilon)
self.args = args
def __call__(
self,
x: mx.array,
mask: Optional[mx.array] = None,
cache: Optional[Tuple[mx.array, mx.array]] = None,
) -> mx.array:
r = self.attn(self.ln_1(x), mask, cache)
h = x + r
r = self.mlp(self.ln_2(h))
out = h + r
return out
class GPTBigCodeModel(nn.Module):
def __init__(self, args: ModelArgs):
super().__init__()
self.args = args
self.vocab_size = args.vocab_size
assert self.vocab_size > 0
self.wte = nn.Embedding(args.vocab_size, args.n_embd)
self.wpe = nn.Embedding(args.n_positions, args.n_embd)
self.h = [TransformerBlock(args=args) for _ in range(args.n_layer)]
self.ln_f = nn.LayerNorm(args.n_embd, eps=args.layer_norm_epsilon)
def __call__(
self,
inputs: mx.array,
cache=None,
):
B, L = inputs.shape
hidden_states = self.wte(inputs)
mask = None
if hidden_states.shape[1] > 1:
position_ids = mx.array(np.arange(L))
hidden_states += self.wpe(position_ids)
mask = create_additive_causal_mask(
hidden_states.shape[1], cache[0].offset if cache is not None else 0
)
mask = mask.astype(hidden_states.dtype)
if cache is None:
cache = [None] * len(self.h)
for layer, c in zip(self.h, cache):
hidden_states = layer(hidden_states, mask, cache=c)
return self.ln_f(hidden_states)
class Model(nn.Module):
def __init__(self, args: ModelArgs):
super().__init__()
self.args = args
self.model_type = args.model_type
self.transformer = GPTBigCodeModel(args)
if not args.tie_word_embeddings:
self.lm_head = nn.Linear(args.n_embd, args.vocab_size, bias=False)
def __call__(
self,
inputs: mx.array,
cache=None,
):
out = self.transformer(inputs, cache)
if self.args.tie_word_embeddings:
out = self.transformer.wte.as_linear(out)
else:
out = self.lm_head(out)
return out
@property
def layers(self):
return self.transformer.h
@property
def head_dim(self):
return self.args.n_embd // self.args.n_head
@property
def n_kv_heads(self):
return self.args.num_key_value_heads

View File

@@ -0,0 +1,198 @@
from dataclasses import dataclass
from typing import Dict, Optional, Tuple, Union
import mlx.core as mx
import mlx.nn as nn
from .base import BaseModelArgs
@dataclass
class ModelArgs(BaseModelArgs):
model_type: str
hidden_size: int
num_hidden_layers: int
intermediate_size: int
num_attention_heads: int
rms_norm_eps: float
vocab_size: int
bias: bool = True
num_key_value_heads: int = None
rope_theta: float = 10000
rope_traditional: bool = False
rope_scaling: Optional[Dict[str, Union[float, str]]] = None
tie_word_embeddings: bool = False
def __post_init__(self):
if self.num_key_value_heads is None:
self.num_key_value_heads = self.num_attention_heads
if self.rope_scaling:
required_keys = {"factor", "type"}
if not all(key in self.rope_scaling for key in required_keys):
raise ValueError(f"rope_scaling must contain keys {required_keys}")
if self.rope_scaling["type"] != "linear":
raise ValueError("rope_scaling 'type' currently only supports 'linear'")
class Attention(nn.Module):
def __init__(self, args: ModelArgs):
super().__init__()
dim = args.hidden_size
self.n_heads = n_heads = args.num_attention_heads
self.n_kv_heads = n_kv_heads = args.num_key_value_heads
self.n_kv_groups = n_heads // args.num_key_value_heads
self.head_dim = head_dim = args.hidden_size // n_heads
self.scale = head_dim**-0.5
self.wqkv = nn.Linear(
dim, (n_heads + 2 * n_kv_heads) * head_dim, bias=args.bias
)
self.wo = nn.Linear(n_heads * head_dim, dim, bias=args.bias)
rope_scale = (
1 / args.rope_scaling["factor"]
if args.rope_scaling is not None and args.rope_scaling["type"] == "linear"
else 1
)
self.rope = nn.RoPE(
head_dim,
traditional=args.rope_traditional,
base=args.rope_theta,
scale=rope_scale,
)
def __call__(
self,
x: mx.array,
mask: Optional[mx.array] = None,
cache: Optional[Tuple[mx.array, mx.array]] = None,
) -> mx.array:
B, L, D = x.shape
qkv_states = self.wqkv(x)
qkv_states = qkv_states.reshape(B, L, -1, 2 + self.n_kv_groups, self.head_dim)
queries = qkv_states[..., : self.n_kv_groups, :]
queries = queries.reshape(B, L, -1, self.head_dim)
keys = qkv_states[..., -2, :]
values = qkv_states[..., -1, :]
# Prepare the queries, keys and values for the attention computation
queries = queries.reshape(B, L, self.n_heads, -1).transpose(0, 2, 1, 3)
keys = keys.reshape(B, L, self.n_kv_heads, -1).transpose(0, 2, 1, 3)
values = values.reshape(B, L, self.n_kv_heads, -1).transpose(0, 2, 1, 3)
if cache is not None:
queries = self.rope(queries, offset=cache.offset)
keys = self.rope(keys, offset=cache.offset)
keys, values = cache.update_and_fetch(keys, values)
else:
queries = self.rope(queries)
keys = self.rope(keys)
output = mx.fast.scaled_dot_product_attention(
queries, keys, values, scale=self.scale, mask=mask
)
output = output.transpose(0, 2, 1, 3).reshape(B, L, -1)
return self.wo(output)
class MLP(nn.Module):
def __init__(self, dim, hidden_dim):
super().__init__()
self.w1 = nn.Linear(dim, hidden_dim, bias=False)
self.w2 = nn.Linear(hidden_dim, dim, bias=False)
self.w3 = nn.Linear(dim, hidden_dim, bias=False)
def __call__(self, x) -> mx.array:
return self.w2(nn.silu(self.w1(x)) * self.w3(x))
class TransformerBlock(nn.Module):
def __init__(self, args: ModelArgs):
super().__init__()
self.attention = Attention(args)
self.feed_forward = MLP(args.hidden_size, args.intermediate_size)
self.attention_norm = nn.RMSNorm(args.hidden_size, eps=args.rms_norm_eps)
self.ffn_norm = nn.RMSNorm(args.hidden_size, eps=args.rms_norm_eps)
def __call__(
self,
x: mx.array,
mask: Optional[mx.array] = None,
cache: Optional[Tuple[mx.array, mx.array]] = None,
) -> mx.array:
r = self.attention(self.attention_norm(x), mask, cache)
h = x + r
r = self.feed_forward(self.ffn_norm(h))
out = h + r
return out
class InternLM2Model(nn.Module):
def __init__(self, args: ModelArgs):
super().__init__()
assert args.vocab_size > 0
self.tok_embeddings = nn.Embedding(args.vocab_size, args.hidden_size)
self.layers = [
TransformerBlock(args=args) for _ in range(args.num_hidden_layers)
]
self.norm = nn.RMSNorm(args.hidden_size, eps=args.rms_norm_eps)
def __call__(
self,
inputs: mx.array,
cache=None,
):
h = self.tok_embeddings(inputs)
mask = None
if h.shape[1] > 1:
mask = nn.MultiHeadAttention.create_additive_causal_mask(h.shape[1])
mask = mask.astype(h.dtype)
if cache is None:
cache = [None] * len(self.layers)
for layer, c in zip(self.layers, cache):
h = layer(h, mask, cache=c)
return self.norm(h)
class Model(nn.Module):
def __init__(self, args: ModelArgs):
super().__init__()
self.args = args
self.model_type = args.model_type
self.model = InternLM2Model(args)
if not args.tie_word_embeddings:
self.output = nn.Linear(args.hidden_size, args.vocab_size, bias=False)
def __call__(
self,
inputs: mx.array,
cache=None,
):
out = self.model(inputs, cache)
if self.args.tie_word_embeddings:
out = self.model.tok_embeddings.as_linear(out)
else:
out = self.output(out)
return out
@property
def layers(self):
return self.model.layers
@property
def head_dim(self):
return self.args.hidden_size // self.args.num_attention_heads
@property
def n_kv_heads(self):
return self.args.num_key_value_heads

220
llms/mlx_lm/models/llama.py Normal file
View File

@@ -0,0 +1,220 @@
from dataclasses import dataclass
from typing import Dict, Optional, Tuple, Union
import mlx.core as mx
import mlx.nn as nn
from .base import BaseModelArgs, KVCache, create_additive_causal_mask
@dataclass
class ModelArgs(BaseModelArgs):
model_type: str
hidden_size: int
num_hidden_layers: int
intermediate_size: int
num_attention_heads: int
rms_norm_eps: float
vocab_size: int
num_key_value_heads: Optional[int] = None
attention_bias: bool = False
mlp_bias: bool = False
rope_theta: float = 10000
rope_traditional: bool = False
rope_scaling: Optional[Dict[str, Union[float, str]]] = None
tie_word_embeddings: bool = True
def __post_init__(self):
if self.num_key_value_heads is None:
self.num_key_value_heads = self.num_attention_heads
if self.rope_scaling:
required_keys = {"factor", "type"}
if not all(key in self.rope_scaling for key in required_keys):
raise ValueError(f"rope_scaling must contain keys {required_keys}")
if self.rope_scaling["type"] != "linear":
raise ValueError("rope_scaling 'type' currently only supports 'linear'")
class Attention(nn.Module):
def __init__(self, args: ModelArgs):
super().__init__()
dim = args.hidden_size
self.n_heads = n_heads = args.num_attention_heads
self.n_kv_heads = n_kv_heads = args.num_key_value_heads
head_dim = args.hidden_size // n_heads
self.scale = head_dim**-0.5
if hasattr(args, "attention_bias"):
attention_bias = args.attention_bias
else:
attention_bias = False
self.q_proj = nn.Linear(dim, n_heads * head_dim, bias=attention_bias)
self.k_proj = nn.Linear(dim, n_kv_heads * head_dim, bias=attention_bias)
self.v_proj = nn.Linear(dim, n_kv_heads * head_dim, bias=attention_bias)
self.o_proj = nn.Linear(n_heads * head_dim, dim, bias=attention_bias)
rope_scale = (
1 / args.rope_scaling["factor"]
if args.rope_scaling is not None and args.rope_scaling["type"] == "linear"
else 1
)
self.rope = nn.RoPE(
head_dim,
traditional=args.rope_traditional,
base=args.rope_theta,
scale=rope_scale,
)
def __call__(
self,
x: mx.array,
mask: Optional[mx.array] = None,
cache: Optional[KVCache] = None,
) -> mx.array:
B, L, D = x.shape
queries, keys, values = self.q_proj(x), self.k_proj(x), self.v_proj(x)
# Prepare the queries, keys and values for the attention computation
queries = queries.reshape(B, L, self.n_heads, -1).transpose(0, 2, 1, 3)
keys = keys.reshape(B, L, self.n_kv_heads, -1).transpose(0, 2, 1, 3)
values = values.reshape(B, L, self.n_kv_heads, -1).transpose(0, 2, 1, 3)
if cache is not None:
queries = self.rope(queries, offset=cache.offset)
keys = self.rope(keys, offset=cache.offset)
keys, values = cache.update_and_fetch(keys, values)
else:
queries = self.rope(queries)
keys = self.rope(keys)
output = mx.fast.scaled_dot_product_attention(
queries, keys, values, scale=self.scale, mask=mask
)
output = output.transpose(0, 2, 1, 3).reshape(B, L, -1)
return self.o_proj(output)
class MLP(nn.Module):
def __init__(self, args: ModelArgs):
super().__init__()
dim = args.hidden_size
hidden_dim = args.intermediate_size
if hasattr(args, "mlp_bias"):
mlp_bias = args.mlp_bias
else:
mlp_bias = False
self.gate_proj = nn.Linear(dim, hidden_dim, bias=mlp_bias)
self.down_proj = nn.Linear(hidden_dim, dim, bias=mlp_bias)
self.up_proj = nn.Linear(dim, hidden_dim, bias=mlp_bias)
def __call__(self, x) -> mx.array:
return self.down_proj(nn.silu(self.gate_proj(x)) * self.up_proj(x))
class TransformerBlock(nn.Module):
def __init__(self, args: ModelArgs):
super().__init__()
self.num_attention_heads = args.num_attention_heads
self.hidden_size = args.hidden_size
self.self_attn = Attention(args)
self.mlp = MLP(args)
self.input_layernorm = nn.RMSNorm(args.hidden_size, eps=args.rms_norm_eps)
self.post_attention_layernorm = nn.RMSNorm(
args.hidden_size, eps=args.rms_norm_eps
)
self.args = args
def __call__(
self,
x: mx.array,
mask: Optional[mx.array] = None,
cache: Optional[KVCache] = None,
) -> mx.array:
r = self.self_attn(self.input_layernorm(x), mask, cache)
h = x + r
r = self.mlp(self.post_attention_layernorm(h))
out = h + r
return out
class LlamaModel(nn.Module):
def __init__(self, args: ModelArgs):
super().__init__()
self.args = args
self.vocab_size = args.vocab_size
self.num_hidden_layers = args.num_hidden_layers
assert self.vocab_size > 0
self.embed_tokens = nn.Embedding(args.vocab_size, args.hidden_size)
self.layers = [
TransformerBlock(args=args) for _ in range(args.num_hidden_layers)
]
self.norm = nn.RMSNorm(args.hidden_size, eps=args.rms_norm_eps)
def __call__(
self,
inputs: mx.array,
cache=None,
):
h = self.embed_tokens(inputs)
mask = None
if h.shape[1] > 1:
mask = create_additive_causal_mask(
h.shape[1], cache[0].offset if cache is not None else 0
)
mask = mask.astype(h.dtype)
if cache is None:
cache = [None] * len(self.layers)
for layer, c in zip(self.layers, cache):
h = layer(h, mask, cache=c)
return self.norm(h)
class Model(nn.Module):
def __init__(self, args: ModelArgs):
super().__init__()
self.args = args
self.model_type = args.model_type
self.model = LlamaModel(args)
if not args.tie_word_embeddings:
self.lm_head = nn.Linear(args.hidden_size, args.vocab_size, bias=False)
def __call__(
self,
inputs: mx.array,
cache=None,
):
out = self.model(inputs, cache)
if self.args.tie_word_embeddings:
out = self.model.embed_tokens.as_linear(out)
else:
out = self.lm_head(out)
return out
def sanitize(self, weights):
# Remove unused precomputed rotary freqs
return {
k: v for k, v in weights.items() if "self_attn.rotary_emb.inv_freq" not in k
}
@property
def layers(self):
return self.model.layers
@property
def head_dim(self):
return self.args.hidden_size // self.args.num_attention_heads
@property
def n_kv_heads(self):
return self.args.num_key_value_heads

View File

@@ -0,0 +1,216 @@
from dataclasses import dataclass
from typing import Dict, Optional, Tuple, Union
import mlx.core as mx
import mlx.nn as nn
import numpy as np
from .base import BaseModelArgs
@dataclass
class ModelArgs(BaseModelArgs):
model_type: str
hidden_size: int
dim_model_base: int
num_hidden_layers: int
intermediate_size: int
num_attention_heads: int
rms_norm_eps: float
vocab_size: int
num_key_value_heads: int
scale_depth: float
scale_emb: float
rope_theta: float = 1000000.0
rope_traditional: bool = False
rope_scaling: Optional[Dict[str, Union[str, float]]] = None
tie_word_embeddings: bool = False
class MLP(nn.Module):
def __init__(self, args):
super().__init__()
self.gate_proj = nn.Linear(args.hidden_size, args.intermediate_size, bias=False)
self.up_proj = nn.Linear(args.hidden_size, args.intermediate_size, bias=False)
self.down_proj = nn.Linear(args.intermediate_size, args.hidden_size, bias=False)
def __call__(self, x):
return self.down_proj(nn.silu(self.gate_proj(x)) * self.up_proj(x))
class Attention(nn.Module):
def __init__(self, args: ModelArgs):
super().__init__()
self.args = args
self.hidden_size = args.hidden_size
self.num_heads = n_heads = args.num_attention_heads
self.rope_theta = args.rope_theta
self.head_dim = head_dim = args.hidden_size // n_heads
self.scale = head_dim**-0.5
self.num_key_value_heads = args.num_key_value_heads
self.num_key_value_groups = self.num_heads // self.num_key_value_heads
self.q_proj = nn.Linear(
self.hidden_size, self.num_heads * self.head_dim, bias=False
)
self.k_proj = nn.Linear(
self.hidden_size, self.num_key_value_heads * self.head_dim, bias=False
)
self.v_proj = nn.Linear(
self.hidden_size, self.num_key_value_heads * self.head_dim, bias=False
)
self.o_proj = nn.Linear(
self.num_heads * self.head_dim, self.hidden_size, bias=False
)
rope_scale = (
1 / args.rope_scaling["factor"]
if args.rope_scaling is not None and args.rope_scaling["type"] == "linear"
else 1
)
self.rope = nn.RoPE(
dims=self.head_dim,
traditional=args.rope_traditional,
base=self.rope_theta,
scale=rope_scale,
)
def __call__(
self,
x: mx.array,
mask: Optional[mx.array] = None,
cache: Optional[Tuple[mx.array, mx.array]] = None,
):
B, L, _ = x.shape
queries, keys, values = self.q_proj(x), self.k_proj(x), self.v_proj(x)
queries = queries.reshape(B, L, self.num_heads, -1).transpose(0, 2, 1, 3)
keys = keys.reshape(B, L, self.num_key_value_heads, -1).transpose(0, 2, 1, 3)
values = values.reshape(B, L, self.num_key_value_heads, -1).transpose(
0, 2, 1, 3
)
if cache is not None:
queries = self.rope(queries, offset=cache.offset)
keys = self.rope(keys, offset=cache.offset)
keys, values = cache.update_and_fetch(keys, values)
else:
queries = self.rope(queries)
keys = self.rope(keys)
attn_output = mx.fast.scaled_dot_product_attention(
queries, keys, values, scale=self.scale, mask=mask
)
attn_output = attn_output.transpose(0, 2, 1, 3).reshape(B, L, -1)
return self.o_proj(attn_output)
class DecoderLayer(nn.Module):
def __init__(self, args: ModelArgs):
super().__init__()
self.args = args
self.hidden_size = args.hidden_size
self.num_hidden_layers = args.num_hidden_layers
self.self_attn = Attention(args)
self.mlp = MLP(args)
self.input_layernorm = nn.RMSNorm(args.hidden_size, eps=args.rms_norm_eps)
self.post_attention_layernorm = nn.RMSNorm(
args.hidden_size, eps=args.rms_norm_eps
)
self.scale_depth = args.scale_depth
self.num_hidden_layers = args.num_hidden_layers
def __call__(
self,
x: mx.array,
mask: Optional[mx.array] = None,
cache: Optional[Tuple[mx.array, mx.array]] = None,
) -> mx.array:
r = self.self_attn(self.input_layernorm(x), mask, cache)
h = x + r * (self.scale_depth / np.sqrt(self.num_hidden_layers))
r = self.mlp(self.post_attention_layernorm(h))
out = h + r * (self.scale_depth / np.sqrt(self.num_hidden_layers))
return out
class MiniCPMModel(nn.Module):
def __init__(self, args: ModelArgs):
super().__init__()
self.args = args
self.vocab_size = args.vocab_size
assert self.vocab_size > 0
self.embed_tokens = nn.Embedding(args.vocab_size, args.hidden_size)
self.layers = [DecoderLayer(args) for _ in range(args.num_hidden_layers)]
self.norm = nn.RMSNorm(args.hidden_size, eps=args.rms_norm_eps)
def __call__(
self,
inputs: mx.array,
cache=None,
):
h = self.embed_tokens(inputs) * self.args.scale_emb
mask = None
if h.shape[1] > 1:
mask = nn.MultiHeadAttention.create_additive_causal_mask(h.shape[1])
mask = mask.astype(h.dtype)
if cache is None:
cache = [None] * len(self.layers)
for layer, c in zip(self.layers, cache):
h = layer(h, mask, c)
return self.norm(h)
class Model(nn.Module):
def __init__(self, args: ModelArgs):
super().__init__()
self.args = args
self.model_type = args.model_type
self.model = MiniCPMModel(args)
if not self.args.tie_word_embeddings:
self.lm_head = nn.Linear(args.hidden_size, args.vocab_size, bias=False)
def __call__(
self,
inputs: mx.array,
cache=None,
):
out = self.model(inputs, cache)
if not self.args.tie_word_embeddings:
out = self.lm_head(out / (self.args.hidden_size / self.args.dim_model_base))
else:
out = out @ self.model.embed_tokens.weight.T
return out
def sanitize(self, weights):
if "lm_head.weight" not in weights:
weights["lm_head.weight"] = weights["model.embed_tokens.weight"]
return weights
@property
def layers(self):
return self.model.layers
@property
def head_dim(self):
return self.args.hidden_size // self.args.num_attention_heads
@property
def n_kv_heads(self):
return self.args.num_key_value_heads

View File

@@ -0,0 +1,227 @@
import math
from dataclasses import dataclass
from typing import Dict, Optional, Tuple, Union
import mlx.core as mx
import mlx.nn as nn
from .base import BaseModelArgs
from .switch_layers import SwitchGLU
@dataclass
class ModelArgs(BaseModelArgs):
model_type: str
vocab_size: int = 32000
hidden_size: int = 4096
intermediate_size: int = 14336
num_hidden_layers: int = 32
num_attention_heads: int = 32
num_experts_per_tok: int = 2
num_key_value_heads: int = 8
num_local_experts: int = 8
rms_norm_eps: float = 1e-5
rope_theta: float = 1e6
rope_traditional: bool = False
rope_scaling: Optional[Dict[str, Union[float, str]]] = None
def __post_init__(self):
if self.num_key_value_heads is None:
self.num_key_value_heads = self.num_attention_heads
class MixtralAttention(nn.Module):
def __init__(self, args: ModelArgs):
super().__init__()
self.hidden_size = args.hidden_size
self.num_heads = args.num_attention_heads
self.head_dim = self.hidden_size // self.num_heads
self.num_key_value_heads = args.num_key_value_heads
self.rope_theta = args.rope_theta
self.scale = self.head_dim**-0.5
self.q_proj = nn.Linear(
self.hidden_size, self.num_heads * self.head_dim, bias=False
)
self.k_proj = nn.Linear(
self.hidden_size, self.num_key_value_heads * self.head_dim, bias=False
)
self.v_proj = nn.Linear(
self.hidden_size, self.num_key_value_heads * self.head_dim, bias=False
)
self.o_proj = nn.Linear(
self.num_heads * self.head_dim, self.hidden_size, bias=False
)
self.rope = nn.RoPE(
self.head_dim,
traditional=args.rope_traditional,
base=args.rope_theta,
)
def __call__(
self,
x: mx.array,
mask: Optional[mx.array] = None,
cache: Optional[Tuple[mx.array, mx.array]] = None,
) -> mx.array:
B, L, D = x.shape
queries, keys, values = self.q_proj(x), self.k_proj(x), self.v_proj(x)
# Prepare the queries, keys and values for the attention computation
queries = queries.reshape(B, L, self.num_heads, -1).transpose(0, 2, 1, 3)
keys = keys.reshape(B, L, self.num_key_value_heads, -1).transpose(0, 2, 1, 3)
values = values.reshape(B, L, self.num_key_value_heads, -1).transpose(
0, 2, 1, 3
)
if cache is not None:
queries = self.rope(queries, offset=cache.offset)
keys = self.rope(keys, offset=cache.offset)
keys, values = cache.update_and_fetch(keys, values)
else:
queries = self.rope(queries)
keys = self.rope(keys)
output = mx.fast.scaled_dot_product_attention(
queries, keys, values, scale=self.scale, mask=mask
)
output = output.transpose(0, 2, 1, 3).reshape(B, L, -1)
return self.o_proj(output)
class MixtralSparseMoeBlock(nn.Module):
def __init__(self, args: ModelArgs):
super().__init__()
self.hidden_dim = args.hidden_size
self.ffn_dim = args.intermediate_size
self.num_experts = args.num_local_experts
self.num_experts_per_tok = args.num_experts_per_tok
# gating
self.gate = nn.Linear(self.hidden_dim, self.num_experts, bias=False)
self.switch_mlp = SwitchGLU(self.hidden_dim, self.ffn_dim, self.num_experts)
def __call__(self, x: mx.array) -> mx.array:
gates = self.gate(x)
k = self.num_experts_per_tok
inds = mx.stop_gradient(mx.argpartition(-gates, kth=k - 1, axis=-1)[..., :k])
scores = mx.take_along_axis(gates, inds, axis=-1)
scores = mx.softmax(scores, axis=-1, precise=True)
y = self.switch_mlp(x, inds)
y = (y * scores[..., None]).sum(axis=-2)
return y
class MixtralDecoderLayer(nn.Module):
def __init__(self, args: ModelArgs):
super().__init__()
self.hidden_size = args.hidden_size
self.self_attn = MixtralAttention(args)
self.block_sparse_moe = MixtralSparseMoeBlock(args)
self.input_layernorm = nn.RMSNorm(args.hidden_size, eps=args.rms_norm_eps)
self.post_attention_layernorm = nn.RMSNorm(
args.hidden_size, eps=args.rms_norm_eps
)
def __call__(
self,
x: mx.array,
mask: Optional[mx.array] = None,
cache: Optional[Tuple[mx.array, mx.array]] = None,
) -> mx.array:
r = self.self_attn(self.input_layernorm(x), mask, cache)
h = x + r
r = self.block_sparse_moe(self.post_attention_layernorm(h))
out = h + r
return out
class MixtralModel(nn.Module):
def __init__(self, args: ModelArgs):
super().__init__()
self.vocab_size = args.vocab_size
self.num_hidden_layers = args.num_hidden_layers
self.embed_tokens = nn.Embedding(args.vocab_size, args.hidden_size)
self.layers = [
MixtralDecoderLayer(args=args) for _ in range(args.num_hidden_layers)
]
self.norm = nn.RMSNorm(args.hidden_size, eps=args.rms_norm_eps)
def __call__(
self,
inputs: mx.array,
cache=None,
):
h = self.embed_tokens(inputs)
mask = None
T = h.shape[1]
if T > 1:
mask = nn.MultiHeadAttention.create_additive_causal_mask(T)
mask = mask.astype(h.dtype)
if cache is None:
cache = [None] * len(self.layers)
for layer, c in zip(self.layers, cache):
h = layer(h, mask, c)
return self.norm(h)
class Model(nn.Module):
def __init__(self, args: ModelArgs):
super().__init__()
self.model_type = args.model_type
self.model = MixtralModel(args)
self.lm_head = nn.Linear(args.hidden_size, args.vocab_size, bias=False)
self.args = args
def __call__(
self,
inputs: mx.array,
cache=None,
):
out = self.model(inputs, cache)
return self.lm_head(out)
def sanitize(self, weights):
if "model.layers.0.block_sparse_moe.experts.0.w1.weight" not in weights:
return weights
for l in range(self.args.num_hidden_layers):
prefix = f"model.layers.{l}"
for n, m in [("w1", "gate_proj"), ("w2", "down_proj"), ("w3", "up_proj")]:
for k in ["weight", "scales", "biases"]:
if f"{prefix}.block_sparse_moe.experts.0.{n}.{k}" in weights:
to_join = [
weights.pop(
f"{prefix}.block_sparse_moe.experts.{e}.{n}.{k}"
)
for e in range(self.args.num_local_experts)
]
weights[f"{prefix}.block_sparse_moe.switch_mlp.{m}.{k}"] = (
mx.stack(to_join)
)
return weights
@property
def layers(self):
return self.model.layers
@property
def head_dim(self):
return self.args.hidden_size // self.args.num_attention_heads
@property
def n_kv_heads(self):
return self.args.num_key_value_heads

185
llms/mlx_lm/models/olmo.py Normal file
View File

@@ -0,0 +1,185 @@
from dataclasses import dataclass
from sys import exit
from typing import Optional, Tuple
import mlx.core as mx
import mlx.nn as nn
from .base import BaseModelArgs
try:
import hf_olmo
except ImportError:
print("To run olmo install ai2-olmo: pip install ai2-olmo")
exit(1)
@dataclass
class ModelArgs(BaseModelArgs):
model_type: str
d_model: int
n_layers: int
mlp_hidden_size: int
n_heads: int
vocab_size: int
embedding_size: int
rope_theta: float = 10000
rope_traditional: bool = False
mlp_ratio: int = 4
weight_tying: bool = False
def __post_init__(self):
self.mlp_hidden_size = (
self.mlp_hidden_size
if self.mlp_hidden_size is not None
else self.mlp_ratio * self.d_model
)
class TransformerBlock(nn.Module):
def __init__(self, args: ModelArgs):
super().__init__()
self.n_heads = args.n_heads
dim = args.d_model
self.ff_proj = nn.Linear(dim, args.mlp_hidden_size, bias=False)
self.ff_out = nn.Linear(args.mlp_hidden_size // 2, dim, bias=False)
self.att_norm = nn.LayerNorm(dim, affine=False)
self.ff_norm = nn.LayerNorm(dim, affine=False)
head_dim = dim // self.n_heads
self.scale = head_dim**-0.5
self.att_proj = nn.Linear(dim, 3 * dim, bias=False)
self.attn_out = nn.Linear(dim, dim, bias=False)
self.rope = nn.RoPE(
head_dim,
traditional=args.rope_traditional,
base=args.rope_theta,
)
self.args = args
def attend(
self,
x: mx.array,
mask: Optional[mx.array] = None,
cache: Optional[Tuple[mx.array, mx.array]] = None,
) -> mx.array:
B, L, D = x.shape
queries, keys, values = mx.split(self.att_proj(x), 3, axis=-1)
# Prepare the queries, keys and values for the attention computation
queries = queries.reshape(B, L, self.n_heads, -1).transpose(0, 2, 1, 3)
keys = keys.reshape(B, L, self.n_heads, -1).transpose(0, 2, 1, 3)
values = values.reshape(B, L, self.n_heads, -1).transpose(0, 2, 1, 3)
if cache is not None:
queries = self.rope(queries, offset=cache.offset)
keys = self.rope(keys, offset=cache.offset)
keys, values = cache.update_and_fetch(keys, values)
else:
queries = self.rope(queries)
keys = self.rope(keys)
scores = (queries * self.scale) @ keys.transpose(0, 1, 3, 2)
if mask is not None:
scores += mask
scores = mx.softmax(scores.astype(mx.float32), axis=-1).astype(scores.dtype)
output = (scores @ values).transpose(0, 2, 1, 3).reshape(B, L, -1)
return self.attn_out(output)
def __call__(
self,
x: mx.array,
mask: Optional[mx.array] = None,
cache: Optional[Tuple[mx.array, mx.array]] = None,
) -> mx.array:
r = self.attend(self.att_norm(x), mask, cache)
h = x + r
x1, x2 = mx.split(self.ff_proj(self.ff_norm(h)), 2, axis=-1)
out = h + self.ff_out(nn.silu(x2) * x1)
return out
class Transformer(nn.Module):
def __init__(self, args: ModelArgs):
super().__init__()
self.n_layers = args.n_layers
self.weight_tying = args.weight_tying
self.wte = nn.Embedding(args.embedding_size, args.d_model)
self.blocks = [TransformerBlock(args=args) for _ in range(args.n_layers)]
if not self.weight_tying:
self.ff_out = nn.Linear(args.d_model, args.embedding_size, bias=False)
self.norm = nn.LayerNorm(args.d_model, affine=False)
def __call__(
self,
inputs: mx.array,
cache=None,
):
h = self.wte(inputs)
mask = None
if h.shape[1] > 1:
mask = nn.MultiHeadAttention.create_additive_causal_mask(h.shape[1])
mask = mask.astype(h.dtype)
if cache is None:
cache = [None] * len(self.blocks)
for block, c in zip(self.blocks, cache):
h = block(h, mask, c)
h = self.norm(h)
if self.weight_tying:
return self.wte.as_linear(h), cache
return self.ff_out(h)
class OlmoModel(nn.Module):
def __init__(self, args: ModelArgs):
super().__init__()
self.transformer = Transformer(args)
def __call__(
self,
inputs: mx.array,
cache=None,
):
return self.transformer(inputs, cache)
class Model(nn.Module):
def __init__(self, args: ModelArgs):
super().__init__()
self.model_type = args.model_type
self.model = OlmoModel(args)
self.args = args
def __call__(
self,
inputs: mx.array,
cache=None,
):
return self.model(inputs, cache)
@property
def layers(self):
return self.model.transformer.blocks
@property
def head_dim(self):
return self.args.d_model // self.args.n_heads
@property
def n_kv_heads(self):
return self.args.n_heads

View File

@@ -0,0 +1,229 @@
from dataclasses import dataclass
from typing import Dict, List, Optional, Tuple, Union
import mlx.core as mx
import mlx.nn as nn
from .base import BaseModelArgs
@dataclass
class ModelArgs(BaseModelArgs):
model_type: str
head_dim: int
num_transformer_layers: int
model_dim: int
vocab_size: int
ffn_dim_divisor: int
num_query_heads: List
num_kv_heads: List
ffn_multipliers: List
ffn_with_glu: bool = True
normalize_qk_projections: bool = True
share_input_output_layers: bool = True
rms_norm_eps: float = 1e-6
rope_freq_constant: float = 10000
def make_divisible(
v: Union[float, int],
divisor: Optional[int] = 8,
min_value: Optional[Union[float, int]] = None,
) -> Union[float, int]:
"""
This function is taken from the original tf repo.
It ensures that all layers have a channel number that is divisible by the divisor
It can be seen at:
https://github.com/tensorflow/models/blob/2cfc99eff5e5eb729c6793d2f3d03aa1c9be2b15/research/slim/nets/mobilenet/mobilenet.py#L62
Args:
v: input value
divisor: default to 8
min_value: minimum divisor value
Returns:
new_v: new divisible value
"""
if min_value is None:
min_value = divisor
new_v = max(min_value, int(v + divisor / 2) // divisor * divisor)
# Make sure that round down does not go down by more than 10%.
if new_v < 0.9 * v:
new_v += divisor
return new_v
class Attention(nn.Module):
def __init__(self, args: ModelArgs, layer_id: int):
super().__init__()
self.head_dim = head_dim = args.head_dim
self.layer_id = layer_id
self.model_dim = model_dim = args.model_dim
self.n_heads = n_heads = args.num_query_heads[layer_id]
self.n_kv_heads = n_kv_heads = args.num_kv_heads[layer_id]
self.scale = head_dim**-0.5
op_size = (n_heads + (n_kv_heads * 2)) * head_dim
self.qkv_proj = nn.Linear(model_dim, op_size, bias=False)
self.out_proj = nn.Linear(n_heads * head_dim, model_dim, bias=False)
self.normalize_qk_projections = args.normalize_qk_projections
if self.normalize_qk_projections:
self.q_norm = nn.RMSNorm(head_dim, eps=args.rms_norm_eps)
self.k_norm = nn.RMSNorm(head_dim, eps=args.rms_norm_eps)
self.rope = nn.RoPE(head_dim, traditional=False, base=args.rope_freq_constant)
def __call__(
self,
x: mx.array,
mask: Optional[mx.array] = None,
cache: Optional[Tuple[mx.array, mx.array]] = None,
) -> mx.array:
B, L, D = x.shape
qkv = self.qkv_proj(x)
qkv = qkv.reshape(
B, L, self.n_heads + (self.n_kv_heads * 2), self.head_dim
).transpose(0, 2, 1, 3)
queries, keys, values = mx.split(
qkv, [self.n_heads, self.n_heads + self.n_kv_heads], axis=1
)
# Prepare the queries, keys and values for the attention computation
if self.normalize_qk_projections:
queries = self.q_norm(queries)
keys = self.k_norm(keys)
if cache is not None:
queries = self.rope(queries, offset=cache.offset)
keys = self.rope(keys, offset=cache.offset)
keys, values = cache.update_and_fetch(keys, values)
else:
queries = self.rope(queries)
keys = self.rope(keys)
output = mx.fast.scaled_dot_product_attention(
queries, keys, values, scale=self.scale, mask=mask
)
output = output.transpose(0, 2, 1, 3).reshape(B, L, -1)
return self.out_proj(output)
class MLP(nn.Module):
def __init__(self, args: ModelArgs, layer_id: int):
super().__init__()
self.args = args
dim = args.model_dim
ffn_multiplier = args.ffn_multipliers[layer_id]
intermediate_dim = int(
make_divisible(
ffn_multiplier * args.model_dim,
divisor=args.ffn_dim_divisor,
)
)
self.proj_1 = nn.Linear(dim, 2 * intermediate_dim, bias=False)
self.proj_2 = nn.Linear(intermediate_dim, dim, bias=False)
def __call__(self, x) -> mx.array:
x = self.proj_1(x)
gate, x = mx.split(x, 2, axis=-1)
return self.proj_2(nn.silu(gate) * x)
class TransformerBlock(nn.Module):
def __init__(self, args: ModelArgs, layer_id: int):
super().__init__()
dim = args.model_dim
self.attn = Attention(args, layer_id=layer_id)
self.ffn = MLP(args, layer_id=layer_id)
self.ffn_norm = nn.RMSNorm(dim, eps=args.rms_norm_eps)
self.attn_norm = nn.RMSNorm(dim, eps=args.rms_norm_eps)
def __call__(
self,
x: mx.array,
mask: Optional[mx.array] = None,
cache: Optional[Tuple[mx.array, mx.array]] = None,
) -> mx.array:
r = self.attn(self.attn_norm(x), mask, cache)
h = x + r
r = self.ffn(self.ffn_norm(h))
out = h + r
return out
class OpenELMModel(nn.Module):
def __init__(self, args: ModelArgs):
super().__init__()
self.args = args
self.vocab_size = args.vocab_size
self.num_transformer_layers = args.num_transformer_layers
assert self.vocab_size > 0
self.token_embeddings = nn.Embedding(args.vocab_size, args.model_dim)
self.layers = [
TransformerBlock(args, layer_id=layer_id)
for layer_id in range(self.num_transformer_layers)
]
self.norm = nn.RMSNorm(args.model_dim, eps=args.rms_norm_eps)
def __call__(
self,
inputs: mx.array,
cache=None,
):
h = self.token_embeddings(inputs)
mask = None
if h.shape[1] > 1:
mask = nn.MultiHeadAttention.create_additive_causal_mask(h.shape[1])
mask = mask.astype(h.dtype)
if cache is None:
cache = [None] * len(self.layers)
for layer, c in zip(self.layers, cache):
h = layer(h, mask, cache=c)
return self.norm(h)
class Model(nn.Module):
def __init__(self, args: ModelArgs):
super().__init__()
self.args = args
self.model_type = args.model_type
self.transformer = OpenELMModel(args)
if not args.share_input_output_layers:
self.lm_head = nn.Linear(args.model_dim, args.vocab_size, bias=False)
def __call__(
self,
inputs: mx.array,
cache=None,
):
out = self.transformer(inputs, cache)
if self.args.share_input_output_layers:
out = self.transformer.token_embeddings.as_linear(out)
else:
out = self.lm_head(out)
return out
@property
def layers(self):
return self.transformer.layers
@property
def head_dim(self):
return self.args.head_dim
@property
def n_kv_heads(self):
return self.args.num_kv_heads

View File

@@ -0,0 +1,182 @@
from dataclasses import dataclass
from typing import Optional, Tuple
import mlx.core as mx
import mlx.nn as nn
from .base import BaseModelArgs, create_additive_causal_mask
@dataclass
class ParamsArgs(BaseModelArgs):
dim: int
ffn_type: str
n_heads: int
n_layers: int
norm_eps: float
positional_embedding_type: str
post_embed_norm: bool
qk_norm: bool
vocab_size: int
weight_tying: bool
@dataclass
class ModelArgs(BaseModelArgs):
model_type: str
params_args_dict: ParamsArgs
class Attention(nn.Module):
def __init__(self, args: ModelArgs):
super().__init__()
self.dim = args.dim
self.n_heads = args.n_heads
self.head_dim = self.dim // self.n_heads
self.qk_norm = args.qk_norm
self.scale = self.head_dim**-0.5
self.in_proj = nn.Linear(self.dim, 3 * self.dim, bias=False)
self.out_proj = nn.Linear(self.dim, self.dim, bias=False)
if self.qk_norm:
self.q_norm = nn.LayerNorm(args.dim, eps=args.norm_eps, bias=False)
self.k_norm = nn.LayerNorm(args.dim, eps=args.norm_eps, bias=False)
self.rope = nn.RoPE(
self.head_dim,
traditional=False,
)
def __call__(
self,
x: mx.array,
mask: Optional[mx.array] = None,
cache: Optional[Tuple[mx.array, mx.array]] = None,
) -> mx.array:
B, L, D = x.shape
queries, keys, values = self.in_proj(x).split(3, axis=-1)
if self.qk_norm:
queries = self.q_norm(queries)
keys = self.q_norm(keys)
queries = queries.reshape(B, L, self.n_heads, -1).transpose(0, 2, 1, 3)
keys = keys.reshape(B, L, self.n_heads, -1).transpose(0, 2, 1, 3)
values = values.reshape(B, L, self.n_heads, -1).transpose(0, 2, 1, 3)
if cache is not None:
queries = self.rope(queries, offset=cache.offset)
keys = self.rope(keys, offset=cache.offset)
keys, values = cache.update_and_fetch(keys, values)
else:
queries = self.rope(queries)
keys = self.rope(keys)
output = mx.fast.scaled_dot_product_attention(
queries, keys, values, scale=self.scale, mask=mask
)
output = output.transpose(0, 2, 1, 3).reshape(B, L, -1)
return self.out_proj(output)
class MLP(nn.Module):
def __init__(self, args: ModelArgs):
super().__init__()
# https://github.com/mlfoundations/open_lm/blob/c65b43042ff31c0fe26f930decf1ccab1b03ab4b/open_lm/model.py#L254C2-L254C3
hidden_dim = 256 * ((int(2 * 4 * args.dim / 3) + 256 - 1) // 256)
self.w12 = nn.Linear(args.dim, 2 * hidden_dim, bias=False)
self.w3 = nn.Linear(hidden_dim, args.dim, bias=False)
def __call__(self, x) -> mx.array:
gate, x = self.w12(x).split(2, axis=-1)
return self.w3(nn.silu(gate) * x)
class TransformerBlock(nn.Module):
def __init__(self, args: ModelArgs):
super().__init__()
self.attention = Attention(args)
self.feed_forward = MLP(args)
self.ffn_norm = nn.LayerNorm(args.dim, eps=args.norm_eps, bias=False)
self.attention_norm = nn.LayerNorm(args.dim, eps=args.norm_eps, bias=False)
def __call__(
self,
x: mx.array,
mask: Optional[mx.array] = None,
cache: Optional[Tuple[mx.array, mx.array]] = None,
) -> mx.array:
r = self.attention(self.attention_norm(x), mask, cache)
h = x + r
r = self.feed_forward(self.ffn_norm(h))
out = h + r
return out
class OpenLM(nn.Module):
def __init__(self, args: ModelArgs):
super().__init__()
self.args = args
self.tok_embeddings = nn.Embedding(args.vocab_size, args.dim)
self.layers = [TransformerBlock(args=args) for _ in range(args.n_layers)]
self.norm = nn.LayerNorm(args.dim, eps=args.norm_eps, bias=False)
self.output = nn.Linear(args.dim, args.vocab_size, bias=False)
def __call__(
self,
inputs: mx.array,
cache=None,
):
_, L = inputs.shape
h = self.tok_embeddings(inputs)
mask = None
if h.shape[1] > 1:
mask = create_additive_causal_mask(
h.shape[1], cache[0].offset if cache is not None else 0
)
mask = mask.astype(h.dtype)
if cache is None:
cache = [None] * len(self.layers)
for layer, c in zip(self.layers, cache):
h = layer(h, mask, cache=c)
return self.output(self.norm(h))
class Model(nn.Module):
def __init__(self, args: ModelArgs):
super().__init__()
args.params_args_dict = ParamsArgs.from_dict(args.params_args_dict)
self.args = args.params_args_dict
self.model_type = args.model_type
self.model = OpenLM(self.args)
def __call__(
self,
inputs: mx.array,
cache=None,
):
out = self.model(inputs, cache)
return out
def sanitize(self, weights):
# Remove unused precomputed rotary freqs
return {k: v for k, v in weights.items() if "inv_freq" not in k}
@property
def layers(self):
return self.model.layers
@property
def head_dim(self):
return self.args.dim // self.args.n_heads
@property
def n_kv_heads(self):
return self.args.n_heads

180
llms/mlx_lm/models/phi.py Normal file
View File

@@ -0,0 +1,180 @@
import math
from dataclasses import dataclass
from typing import Tuple
import mlx.core as mx
import mlx.nn as nn
from .base import BaseModelArgs
@dataclass
class ModelArgs(BaseModelArgs):
model_type: str = "phi"
max_position_embeddings: int = 2048
vocab_size: int = 51200
hidden_size: int = 2560
num_attention_heads: int = 32
num_hidden_layers: int = 32
num_key_value_heads: int = 32
partial_rotary_factor: float = 0.4
intermediate_size: int = 10240
layer_norm_eps: float = 1e-5
rope_theta: float = 10000.0
def __post_init__(self):
if self.num_key_value_heads is None:
self.num_key_value_heads = self.num_attention_heads
class PhiAttention(nn.Module):
def __init__(self, config: ModelArgs):
super().__init__()
self.hidden_size = config.hidden_size
self.num_heads = config.num_attention_heads
self.head_dim = self.hidden_size // self.num_heads
self.num_key_value_heads = config.num_key_value_heads
self.repeats = self.num_heads // self.num_key_value_heads
self.rope_theta = config.rope_theta
self.partial_rotary_factor = config.partial_rotary_factor
if (self.head_dim * self.num_heads) != self.hidden_size:
raise ValueError(
f"hidden_size must be divisible by num_heads (got `hidden_size`: {self.hidden_size}"
f" and `num_heads`: {self.num_heads})."
)
self.q_proj = nn.Linear(
self.hidden_size, self.num_heads * self.head_dim, bias=True
)
self.k_proj = nn.Linear(
self.hidden_size, self.num_key_value_heads * self.head_dim, bias=True
)
self.v_proj = nn.Linear(
self.hidden_size, self.num_key_value_heads * self.head_dim, bias=True
)
self.dense = nn.Linear(
self.num_heads * self.head_dim, self.hidden_size, bias=True
)
self.rope = nn.RoPE(
int(self.partial_rotary_factor * self.head_dim),
traditional=False,
base=self.rope_theta,
)
def __call__(self, x, mask=None, cache=None):
queries, keys, values = self.q_proj(x), self.k_proj(x), self.v_proj(x)
# Extract some shapes
B, L, D = queries.shape
n_heads, n_kv_heads = self.num_heads, self.num_key_value_heads
# Prepare the queries, keys and values for the attention computation
queries = queries.reshape(
B,
L,
n_heads,
-1,
).moveaxis(1, 2)
keys = keys.reshape(B, L, n_kv_heads, -1).moveaxis(1, 2)
values = values.reshape(B, L, n_kv_heads, -1).moveaxis(1, 2)
# Add RoPE to the queries and keys and combine them with the cache
if cache is not None:
queries = self.rope(queries, offset=cache.offset)
keys = self.rope(keys, offset=cache.offset)
keys, values = cache.update_and_fetch(keys, values)
else:
queries = self.rope(queries)
keys = self.rope(keys)
scale = math.sqrt(1 / queries.shape[-1])
output = mx.fast.scaled_dot_product_attention(
queries.astype(mx.float32), keys, values, scale=scale, mask=mask
).astype(values.dtype)
output = output.moveaxis(2, 1).reshape(B, L, -1)
return self.dense(output)
class PhiMLP(nn.Module):
def __init__(self, config: ModelArgs):
super().__init__()
self.fc1 = nn.Linear(config.hidden_size, config.intermediate_size)
self.fc2 = nn.Linear(config.intermediate_size, config.hidden_size)
self.act = nn.GELU(approx="precise")
def __call__(self, x) -> mx.array:
return self.fc2(self.act(self.fc1(x)))
class PhiDecoderLayer(nn.Module):
def __init__(self, config: ModelArgs):
super().__init__()
self.self_attn = PhiAttention(config=config)
self.input_layernorm = nn.LayerNorm(
config.hidden_size, eps=config.layer_norm_eps
)
self.mlp = PhiMLP(config)
def __call__(self, x, mask, cache):
h = self.input_layernorm(x)
attn_h = self.self_attn(h, mask, cache)
ff_h = self.mlp(h)
return attn_h + ff_h + x
class PhiModel(nn.Module):
def __init__(self, config: ModelArgs):
super().__init__()
self.embed_tokens = nn.Embedding(config.vocab_size, config.hidden_size)
self.layers = [PhiDecoderLayer(config) for i in range(config.num_hidden_layers)]
self.final_layernorm = nn.LayerNorm(
config.hidden_size, eps=config.layer_norm_eps
)
def __call__(self, x, cache):
x = self.embed_tokens(x)
if cache is None:
cache = [None] * len(self.layers)
mask = None
if x.shape[1] > 1:
mask = nn.MultiHeadAttention.create_additive_causal_mask(x.shape[1])
mask = mask.astype(x.dtype)
for layer, c in zip(self.layers, cache):
x = layer(x, mask, c)
return self.final_layernorm(x)
class Model(nn.Module):
def __init__(self, config: ModelArgs):
super().__init__()
self.model_type = config.model_type
self.model = PhiModel(config)
self.lm_head = nn.Linear(config.hidden_size, config.vocab_size, bias=True)
self.args = config
def __call__(
self,
x: mx.array,
cache: mx.array = None,
) -> Tuple[mx.array, mx.array]:
y = self.model(x, cache)
return self.lm_head(y)
@property
def layers(self):
return self.model.layers
@property
def head_dim(self):
return self.args.hidden_size // self.args.num_attention_heads
@property
def n_kv_heads(self):
return self.args.num_key_value_heads

213
llms/mlx_lm/models/phi3.py Normal file
View File

@@ -0,0 +1,213 @@
from dataclasses import dataclass
from typing import Dict, Optional, Tuple, Union
import mlx.core as mx
import mlx.nn as nn
from .base import BaseModelArgs
from .su_rope import SuScaledRotaryEmbedding
@dataclass
class ModelArgs(BaseModelArgs):
model_type: str
hidden_size: int
num_hidden_layers: int
intermediate_size: int
num_attention_heads: int
rms_norm_eps: float
vocab_size: int
num_key_value_heads: int = None
rope_theta: float = 10000
rope_traditional: bool = False
rope_scaling: Optional[Dict[str, Union[float, str]]] = None
max_position_embeddings: int = 131072
original_max_position_embeddings: int = 4096
def __post_init__(self):
if self.num_key_value_heads is None:
self.num_key_value_heads = self.num_attention_heads
if self.rope_scaling:
required_keys = {"long_factor", "type"}
if not all(key in self.rope_scaling for key in required_keys):
raise ValueError(f"rope_scaling must contain keys {required_keys}")
if self.rope_scaling["type"] not in ["su", "linear"]:
print(
"[WARNING] rope_scaling 'type' currently only supports 'linear' and 'su'; setting rope scaling to false."
)
self.rope_scaling = None
class Attention(nn.Module):
def __init__(self, args: ModelArgs):
super().__init__()
dim = args.hidden_size
self.n_heads = n_heads = args.num_attention_heads
self.n_kv_heads = n_kv_heads = args.num_key_value_heads
self.num_hidden_layers = args.num_hidden_layers
self.head_dim = head_dim = args.hidden_size // n_heads
self.scale = head_dim**-0.5
op_size = n_heads * head_dim + 2 * (n_kv_heads * head_dim)
self.qkv_proj = nn.Linear(dim, op_size, bias=False)
self.o_proj = nn.Linear(n_heads * head_dim, dim, bias=False)
rope_scale = 1.0
if args.rope_scaling and args.rope_scaling["type"] == "su":
self.rope = SuScaledRotaryEmbedding(
head_dim,
traditional=False,
base=args.rope_theta,
scale=rope_scale,
max_position_embeddings=args.max_position_embeddings,
original_max_position_embeddings=args.original_max_position_embeddings,
short_factor=args.rope_scaling["short_factor"],
long_factor=args.rope_scaling["long_factor"],
)
else:
if args.rope_scaling and args.rope_scaling["type"] == "linear":
rope_scale = 1 / args.rope_scaling["factor"]
self.rope = nn.RoPE(
head_dim,
traditional=args.rope_traditional,
base=args.rope_theta,
scale=rope_scale,
)
def __call__(
self,
x: mx.array,
mask: Optional[mx.array] = None,
cache: Optional[Tuple[mx.array, mx.array]] = None,
) -> mx.array:
B, L, D = x.shape
qkv = self.qkv_proj(x)
query_pos = self.n_heads * self.head_dim
queries, keys, values = mx.split(
qkv, [query_pos, query_pos + self.n_kv_heads * self.head_dim], axis=-1
)
# Prepare the queries, keys and values for the attention computation
queries = queries.reshape(B, L, self.n_heads, -1).transpose(0, 2, 1, 3)
keys = keys.reshape(B, L, self.n_kv_heads, -1).transpose(0, 2, 1, 3)
values = values.reshape(B, L, self.n_kv_heads, -1).transpose(0, 2, 1, 3)
if cache is not None:
queries = self.rope(queries, offset=cache.offset)
keys = self.rope(keys, offset=cache.offset)
keys, values = cache.update_and_fetch(keys, values)
else:
queries = self.rope(queries)
keys = self.rope(keys)
output = mx.fast.scaled_dot_product_attention(
queries, keys, values, scale=self.scale, mask=mask
)
output = output.transpose(0, 2, 1, 3).reshape(B, L, -1)
return self.o_proj(output)
class MLP(nn.Module):
def __init__(self, dim, hidden_dim):
super().__init__()
self.gate_up_proj = nn.Linear(dim, 2 * hidden_dim, bias=False)
self.down_proj = nn.Linear(hidden_dim, dim, bias=False)
def __call__(self, x) -> mx.array:
x = self.gate_up_proj(x)
gate, x = mx.split(x, 2, axis=-1)
return self.down_proj(nn.silu(gate) * x)
class TransformerBlock(nn.Module):
def __init__(self, args: ModelArgs):
super().__init__()
self.num_attention_heads = args.num_attention_heads
self.hidden_size = args.hidden_size
self.self_attn = Attention(args)
self.mlp = MLP(args.hidden_size, args.intermediate_size)
self.input_layernorm = nn.RMSNorm(args.hidden_size, eps=args.rms_norm_eps)
self.post_attention_layernorm = nn.RMSNorm(
args.hidden_size, eps=args.rms_norm_eps
)
self.args = args
def __call__(
self,
x: mx.array,
mask: Optional[mx.array] = None,
cache: Optional[Tuple[mx.array, mx.array]] = None,
) -> mx.array:
r = self.self_attn(self.input_layernorm(x), mask, cache)
h = x + r
r = self.mlp(self.post_attention_layernorm(h))
out = h + r
return out
class Phi3Model(nn.Module):
def __init__(self, args: ModelArgs):
super().__init__()
self.args = args
self.vocab_size = args.vocab_size
self.num_hidden_layers = args.num_hidden_layers
assert self.vocab_size > 0
self.embed_tokens = nn.Embedding(args.vocab_size, args.hidden_size)
self.layers = [
TransformerBlock(args=args) for _ in range(args.num_hidden_layers)
]
self.norm = nn.RMSNorm(args.hidden_size, eps=args.rms_norm_eps)
def __call__(
self,
inputs: mx.array,
cache=None,
):
h = self.embed_tokens(inputs)
mask = None
if h.shape[1] > 1:
mask = nn.MultiHeadAttention.create_additive_causal_mask(h.shape[1])
mask = mask.astype(h.dtype)
if cache is None:
cache = [None] * len(self.layers)
for layer, c in zip(self.layers, cache):
h = layer(h, mask, c)
return self.norm(h)
class Model(nn.Module):
def __init__(self, args: ModelArgs):
super().__init__()
self.model_type = args.model_type
self.model = Phi3Model(args)
self.lm_head = nn.Linear(args.hidden_size, args.vocab_size, bias=False)
self.args = args
def __call__(
self,
inputs: mx.array,
cache=None,
):
out = self.model(inputs, cache)
return self.lm_head(out)
@property
def layers(self):
return self.model.layers
@property
def head_dim(self):
return self.args.hidden_size // self.args.num_attention_heads
@property
def n_kv_heads(self):
return self.args.num_key_value_heads

View File

@@ -0,0 +1,318 @@
from dataclasses import dataclass
from functools import partial
from typing import Dict, Optional, Tuple, Union
import mlx.core as mx
import mlx.nn as nn
from .base import BaseModelArgs
@dataclass
class ModelArgs(BaseModelArgs):
model_type: str
hidden_size: int
dense_attention_every_n_layers: int
ff_intermediate_size: int
gegelu_limit: float
num_hidden_layers: int
num_attention_heads: int
layer_norm_epsilon: float
vocab_size: int
num_key_value_heads: int = None
mup_attn_multiplier: float = 1.0
mup_use_scaling: bool = True
mup_embedding_multiplier: float = 10.0
mup_width_multiplier: float = 8.0
rope_embedding_base: float = 1000000
rope_position_scale: float = 1.0
blocksparse_block_size: int = (64,)
blocksparse_num_local_blocks: int = 16
blocksparse_vert_stride: int = 8
@partial(mx.compile, shapeless=True)
def gegelu_impl(a_gelu, a_linear, limit):
a_gelu = mx.where(
mx.isinf(a_gelu),
a_gelu,
mx.clip(a_gelu, a_min=None, a_max=limit),
)
a_linear = mx.where(
mx.isinf(a_linear),
a_linear,
mx.clip(a_linear, a_min=-limit, a_max=limit),
)
out_gelu = a_gelu * mx.sigmoid(1.702 * a_gelu)
return out_gelu * (a_linear + 1.0)
def gegelu(x, limit):
a_gelu, a_linear = x[..., ::2], x[..., 1::2]
return gegelu_impl(a_gelu, a_linear, limit)
class Attention(nn.Module):
def __init__(self, args: ModelArgs, layer_idx):
super().__init__()
dim = args.hidden_size
self.n_heads = n_heads = args.num_attention_heads
self.n_kv_heads = n_kv_heads = args.num_key_value_heads
self.n_q_per_kv = n_heads // n_kv_heads
self.head_dim = head_dim = args.hidden_size // n_heads
self.query_key_value = nn.Linear(
dim, (self.n_heads + 2 * self.n_kv_heads) * head_dim
)
self.dense = nn.Linear(dim, dim)
if args.mup_use_scaling:
norm_factor = head_dim / args.mup_attn_multiplier
else:
norm_factor = math.sqrt(head_dim)
self.scale = 1.0 / norm_factor
self.rope = nn.RoPE(
head_dim,
traditional=False,
base=args.rope_embedding_base,
scale=args.rope_position_scale,
)
if layer_idx % args.dense_attention_every_n_layers == 0:
self.block_sparse = True
self.blocksparse_block_size = args.blocksparse_block_size
if self.blocksparse_block_size not in (32, 64):
raise ValueError(
f"Unsupported block size {self.blocksparse_block_size}"
)
self.blocksparse_num_local_blocks = args.blocksparse_num_local_blocks
self.blocksparse_vert_stride = args.blocksparse_vert_stride
else:
self.block_sparse = False
def _block_sparse_mask(self, q_len, kv_len):
vert_stride = self.blocksparse_vert_stride
local_blocks = self.blocksparse_num_local_blocks
block_size = self.blocksparse_block_size
n_heads = self.n_heads
kv_blocks = (kv_len + block_size - 1) // block_size
q_blocks = (q_len + block_size - 1) // block_size
q_pos = mx.arange(kv_blocks - q_blocks, kv_blocks)[None, :, None]
k_pos = mx.arange(kv_blocks)[None, None]
mask_vert_strided = (
mx.arange(kv_blocks)[None, :] + mx.arange(1, n_heads + 1)[:, None]
) % vert_stride
mask_vert_strided = (mask_vert_strided == 0)[:, None, :]
block_mask = (q_pos >= k_pos) & (
(q_pos - k_pos < local_blocks) | mask_vert_strided
)
block_mask = block_mask.reshape(
self.n_kv_heads, self.n_q_per_kv, *block_mask.shape[-2:]
)
dense_mask = mx.repeat(
mx.repeat(block_mask, block_size, axis=-1), block_size, axis=-2
)
return block_mask, dense_mask[..., -q_len:, :kv_len]
def _block_sparse_attention(self, queries, keys, values, scale, mask):
queries = scale * queries
B = queries.shape[0]
L = queries.shape[2]
queries = mx.reshape(queries, (B, self.n_kv_heads, self.n_q_per_kv, L, -1))
keys = mx.expand_dims(keys, 2)
values = mx.expand_dims(values, 2)
# TODO get rid of dense mask if we have a fill value
block_mask, dense_mask = self._block_sparse_mask(L, keys.shape[-2])
scores = queries @ mx.swapaxes(keys, -1, -2)
# TODO, uncomment when faster
# scores = mx.block_masked_mm(
# queries,
# mx.swapaxes(keys, -1, -2),
# mask_out=block_mask,
# block_size=self.blocksparse_block_size,
# )
if mask is not None:
scores = scores + mask
scores = scores + mx.where(
dense_mask, mx.array(0, scores.dtype), mx.array(-float("inf"), scores.dtype)
)
scores = mx.softmax(scores, axis=-1, precise=True)
output = scores @ values
# TODO, uncomment when faster
# output = mx.block_masked_mm(
# scores, values, mask_lhs=block_mask, block_size=self.blocksparse_block_size
# )
return mx.reshape(output, (B, self.n_heads, L, -1))
def __call__(
self,
x: mx.array,
mask: Optional[mx.array] = None,
cache: Optional[Tuple[mx.array, mx.array]] = None,
) -> mx.array:
B, L, D = x.shape
qkv = self.query_key_value(x)
qkv = qkv.reshape(B, L, -1, self.n_q_per_kv + 2, self.head_dim)
queries = qkv[..., :-2, :].flatten(-3, -2)
keys = qkv[..., -2, :]
values = qkv[..., -1, :]
# Prepare the queries, keys and values for the attention computation
queries = queries.transpose(0, 2, 1, 3)
keys = keys.transpose(0, 2, 1, 3)
values = values.transpose(0, 2, 1, 3)
if cache is not None:
queries = self.rope(queries, offset=cache.offset)
keys = self.rope(keys, offset=cache.offset)
keys, values = cache.update_and_fetch(keys, values)
else:
queries = self.rope(queries)
keys = self.rope(keys)
if self.block_sparse:
output = self._block_sparse_attention(
queries, keys, values, scale=self.scale, mask=mask
)
else:
output = mx.fast.scaled_dot_product_attention(
queries, keys, values, scale=self.scale, mask=mask
)
output = output.transpose(0, 2, 1, 3).reshape(B, L, -1)
return self.dense(output)
class MLP(nn.Module):
def __init__(self, args):
super().__init__()
dim = args.hidden_size
hidden_dim = args.ff_intermediate_size
self.gegelu_limit = args.gegelu_limit
self.up_proj = nn.Linear(dim, 2 * hidden_dim)
self.down_proj = nn.Linear(hidden_dim, dim)
def __call__(self, x) -> mx.array:
x = self.up_proj(x)
return self.down_proj(gegelu(x, self.gegelu_limit))
class TransformerBlock(nn.Module):
def __init__(self, args: ModelArgs, layer_idx):
super().__init__()
self.num_attention_heads = args.num_attention_heads
self.hidden_size = args.hidden_size
self.self_attn = Attention(args, layer_idx)
self.mlp = MLP(args)
self.input_layernorm = nn.LayerNorm(
args.hidden_size, eps=args.layer_norm_epsilon
)
self.post_attention_layernorm = nn.LayerNorm(
args.hidden_size,
eps=args.layer_norm_epsilon,
)
self.args = args
def __call__(
self,
x: mx.array,
mask: Optional[mx.array] = None,
cache: Optional[Tuple[mx.array, mx.array]] = None,
) -> mx.array:
r = self.self_attn(self.input_layernorm(x), mask, cache)
h = x + r
r = self.mlp(self.post_attention_layernorm(h))
out = h + r
return out
class Phi3Model(nn.Module):
def __init__(self, args: ModelArgs):
super().__init__()
self.args = args
self.vocab_size = args.vocab_size
self.num_hidden_layers = args.num_hidden_layers
assert self.vocab_size > 0
self.mup_embedding_multiplier = args.mup_embedding_multiplier
self.embed_tokens = nn.Embedding(args.vocab_size, args.hidden_size)
self.layers = [
TransformerBlock(args=args, layer_idx=l)
for l in range(args.num_hidden_layers)
]
self.final_layernorm = nn.LayerNorm(
args.hidden_size, eps=args.layer_norm_epsilon
)
def __call__(
self,
inputs: mx.array,
cache=None,
):
h = self.embed_tokens(inputs)
if self.mup_embedding_multiplier:
h = self.mup_embedding_multiplier * h
mask = None
if h.shape[1] > 1:
mask = nn.MultiHeadAttention.create_additive_causal_mask(h.shape[1])
mask = mask.astype(h.dtype)
if cache is None:
cache = [None] * len(self.layers)
for layer, c in zip(self.layers, cache):
h = layer(h, mask, c)
return self.final_layernorm(h)
class Model(nn.Module):
def __init__(self, args: ModelArgs):
super().__init__()
self.model_type = args.model_type
self.model = Phi3Model(args)
self.args = args
self.mup_width_multiplier = args.mup_width_multiplier
self._dummy_tokenizer_ids = mx.array(
[100256, 100258, 100259, 100260, 100264, 100265]
+ list(range(100267, 100352))
)
def __call__(
self,
inputs: mx.array,
cache=None,
):
out = self.model(inputs, cache)
out = self.model.embed_tokens.as_linear(out)
if self.mup_width_multiplier:
out = out / self.mup_width_multiplier
out[self._dummy_tokenizer_ids] = -float("inf")
return out
@property
def layers(self):
return self.model.layers
@property
def head_dim(self):
return self.args.hidden_size // self.args.num_attention_heads
def sanitize(self, weights):
# Remove unused precomputed rotary freqs
return {
k: v for k, v in weights.items() if "self_attn.rotary_emb.inv_freq" not in k
}
@property
def n_kv_heads(self):
return self.args.num_key_value_heads

Some files were not shown because too many files have changed in this diff Show More