import time import torch from transformers import AutoTokenizer, EsmForMaskedLM # Example protein sequence (Green Fluorescent Protein) protein_sequence = "MSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVTTFSYGVQCFSRYPDHMKQHDFFKSAMPEGYVQERTIFFKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYNSHNVYIMADKQKNGIKVNFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSTQSALSKDPNEKRDHMVLLEFVTAAGITHGMDELYK" # Hugging Face model identifier for ESM-2 (33 layers, 650M params, UR50D training set) model_name = "facebook/esm2_t33_650M_UR50D" # Load tokenizer and model; move model to Apple Metal Performance Shaders (MPS) device tokenizer = AutoTokenizer.from_pretrained(model_name) model = EsmForMaskedLM.from_pretrained(model_name).to("mps") # Number of sequences per forward pass batch_size = 5 # Number of timing iterations steps = 50 # Tokenize input sequence and replicate for the batch # Replicate the same sequence 'batch_size' times to create a batch inputs = tokenizer( [protein_sequence] * batch_size, return_tensors="pt", padding=True, truncation=True, max_length=1024 ) input_ids = inputs["input_ids"].to("mps") attention_mask = inputs["attention_mask"].to("mps") # Warm-up phase for _ in range(10): outputs = model(input_ids=input_ids, attention_mask=attention_mask) torch.mps.synchronize() # Ensure all queued ops on MPS are complete before next step # Timed inference loop tic = time.time() for _ in range(steps): outputs = model(input_ids=input_ids, attention_mask=attention_mask) torch.mps.synchronize() # Wait for computation to finish before timing next iteration toc = time.time() # Compute performance metrics ms_per_step = 1000 * (toc - tic) / steps throughput = batch_size * 1000 / ms_per_step # Report results print(f"Time (ms) per step: {ms_per_step:.3f}") print(f"Throughput: {throughput:.2f} sequences/sec")